UNITED STATES
SECURITIES AND EXCHANGE COMMISSION
WASHINGTON, D.C. 20549
FORM 20-F
(Mark One)
REGISTRATION STATEMENT PURSUANT TO SECTION 12(b) OR (g) OF THE SECURITIES
EXCHANGE ACT OF 1934
ANNUAL REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES
EXCHANGE ACT OF 1934
For the fiscal year ended December 31, 2011
OR
OR
TRANSITION REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES
EXCHANGE ACT OF 1934
For the transition period from to
OR
SHELL COMPANY REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES
EXCHANGE ACT OF 1934
Date of event requiring this shell company report . . . . . . . . . . . . . . . . . . .
Commission file number 001- 35123
GOLAR LNG PARTNERS LP
(Exact name of Registrant as specified in its charter)
Republic of the Marshall Islands
(Jurisdiction of incorporation or organization)
Par-la-Ville Place
14 Par-la-Ville Road
Hamilton, HM 08, Bermuda
(Address of principal executive offices)
Graham Robjohns
Par-la-Ville Place
14 Par-la-Ville Road
Hamilton, HM 08, Bermuda
Telephone: +1 (441) 295-4705
Facsimile: +1 (441) 295-3494
(Name, Telephone, E-mail and/or Facsimile number and Address of Company Contact Person)
Securities registered or to be registered pursuant to Section 12(b) of the Act:
Title of each class
Common units representing limited partner
interests
Name of each exchange on which registered
Nasdaq Global Market
Securities registered or to be registered pursuant to Section 12(g) of the Act: None
Securities for which there is a reporting obligation pursuant to Section 15(d) of the Act: None
,QGLFDWHWKHQXPEHURIRXWVWDQGLQJVKDUHVRIHDFKRIWKHLVVXHU¶VFODVVHVRIFDSLWDORUcommon stock as of the close of the period
covered by the annual report.
23,127,254 Common Units representing limited partner interests
15,949,831 Subordinated Units representing limited partner interests
Indicate by check mark if the registrant is a well-known seasoned issuer, as defined in Rule 405 of the Securities Act.
Yes
No
If this report is an annual or transition report, indicate by check mark if the registrant is not required to file reports pursuant to
Section 13 or 15(d) of the Securities Exchange Act of 1934.
Yes
No
Indicate by check mark whether the registrant (1) has filed all reports required to be filed by Section 13 or 15(d) of the Securities
Exchange Act of 1934 during the preceding 12 months (or for such shorter period that the registrant was required to file such reports),
and (2) has been subject to such filing requirements for the past 90 days.
Yes
No
Indicate by check mark whether the registrant has submitted electronically and posted on its corporate Web site, if any, every
Interactive Data File required to be submitted and posted pursuanWWR5XOHRI5HJXODWLRQ67RIWKLVFKDSWHUGXUing the
preceding 12 months (or for such shorter period that the registrant was required to submit and post such files).
Yes
No
Indicate by check mark whether the registrant is a large accelerated filer, an accelerated filer, or a non-accelerated filer. See definition
RI³DFFHOHUDWHGILOHUDQGODUJHDFFHOHUDWHGILOHU´LQ Rule 12b-2 of the Exchange Act. (Check one):
Large accelerated filer
Accelerated filer
Non-accelerated filer
Indicate by check mark which basis of accounting the registrant has used to prepare the financial statements included in this filing:
U.S. GAAP
International Financial Reporting Standards as issued
by the International Accounting Standards Board
Other
,I³2WKHU´KDVEHHQFKHFNHGLQUHVSRQVHWR the previous question, indicate by check mark which financial statement item the registrant
has elected to follow.
Item 17
Item 18
If this is an annual report, indicate by check mark whether the registrant is a shell company (as defined in Rule 12b-2 of the Exchange
Act).
Yes
No
GOLAR LNG PARTNERS LP
INDEX TO REPORT ON FORM 20-F
Part I
Item 1. Identity of Directors, Senior Management and Advisers
Item 2. Offer Statistics and Expected Timetable
Item 3. Key Information
A. Selected Financial Data
B. Capitalization and Indebtedness
C. Reasons for the Offer and Use of Proceeds
D. Risk Factors
Item 4. Information on the Partnership
A. History and Development of the Partnership
B. Business Overview
C. Organizational Structure
D. Property, Plants and Equipment
Item 4A. Unresolved Staff Comments
Item 5. Operating and Financial Review and Prospects
A. Operating Results
B. Liquidity and Capital Resources
C. Research and Development
D. Trend Information
E. Off-Balance Sheet Arrangements
F. Tabular Disclosure of Contractual Obligations
G. Safe Harbor
Item 6. Directors, Senior Management and Employees
A. Directors and Senior Management
B. Compensation
C. Board Practices
D. Employees
E. Unit Ownership
Item 7. Major Unitholders and Related Party Transactions
A. Major Unitholders
B. Related Party Transactions
C. Interests of Experts and Counsel
Item 8. Financial Information
A. Consolidated Statements and Other Financial Information
B. Significant Changes
Item 9. The Offer and Listing
Item 10. Additional Information
A. Share Capital
B. Memorandum and Articles of Association
C. Material Contracts
D. Exchange Controls
E. Taxation
F. Dividends and Paying Agents
G. Statements by Experts
H. Documents on Display
I. Subsidiary Information
Item 11. Quantitative and Qualitative Disclosures About Market Risk
Item 12. Description of Securities Other than Equity Securities
Part II
Item 13. Defaults, Dividend Arrearages and Delinquencies
Item 14. Material Modifications to the Rights of Security Holders and Use of Proceeds
Item 15. Controls and Procedures
1
1
1
1
1
3
3
3
29
29
30
58
58
58
58
65
71
84
84
84
85
85
86
86
88
88
90
90
90
90
91
103
103
103
105
105
106
106
106
106
108
108
114
114
114
114
114
115
116
116
116
116
Item 16. [Reserved]
Item 16A. Audit Committee Financial Expert
Item 16B. Code of Ethics
Item 16C. Principal Accountant Fees and Services
Item 16D. Exemptions from the Listing Standards for Audit Committees
Item 16E. Purchases of Equity Securities by the Issuer and Affiliated Purchasers
Item 16F. &KDQJHLQ5HJLVWUDQWV¶&HUWLI\LQJ$FFRXQWDQt
Item 16G. Corporate Governance
Item 16H. Mine Safety Disclosure
Part III
Item 17. Financial Statements
Item 18. Financial Statements
Item 19. Exhibits
SIGNATURES
116
116
116
117
117
117
117
118
118
119
119
119
119
121
Presentation of Information in this Annual Report
This Annual Report on Form 20-F for the year ended December 31, 2011, or the Annual Report, should be read in conjunction
with the consolidated and combined financial statements and accompanying notes included in this report. Unless the context otherwise
requires, references in this AnQXDO5HSRUWWR³*RODU/1*3DUWQHUV/3´³*RODU/1*3DUWQHUV´WKH³3DUWQHUVKLS´³ZH´³RXU´
³XV´RUVLPLODUWHUPVUHIHUWR*RODU/1*Partners LP, a Marshall Islands limited partnership, or any one or more of its subsidiaries,
or to all of such entities, and, for periods prior to our initial public offering on April 13, 2011, our Combined Entity. References to our
³&RPELQHG(QWLW\´UHIHUWRWKHVXEVLGLDULHVof Golar LNG Limited that had interests in the vessels in our initial fleet prior to our initial
public offering. 5HIHUHQFHVLQWKLV$QQXDO5HSRUWWR³RXUJHQHUDOSDUWQHU´UHIHUWR*RODU*3//&the general partner of the
Partnership. References in this $QQXDO5HSRUWWR³*RODU´UHIHUGHSHQGLQJRQWKe context, to Golar LNG Limited (NasdaqGS: GLNG)
and to any one or more of its direct and indirect subsidiaries, including Golar LNG Energy Limited or Golar Energy and to Golar
Management Limited (or Golar Management). References in this Annual Report to Golar Wilhelmsen refer to Golar Wilhelmsen AS, a
company that is jointly controlled by both Golar and Wilhelmsen Ship Management (Norway) AS.
5HIHUHQFHVLQWKLV$QQXDO5HSRUWWRRXU³LQLWLDOIOHHW´UHIHr to the Golar Winter, the Golar Spirit, the Golar Mazo and the
Methane Princess, all of which were contributed to us at or prior to our initial public offering5HIHUHQFHVWRRXU³'URSGRZQ
Predecessor´UHIHUWR*RODU)UHH]HZKLFKZHDFTXLUHGsubsequent to our initial public offering. In this Annual Report, we refer to the
vessels in our initial fleet and the Golar Freeze, collectively, as our current fleet.
Cautionary Statement Regarding Forward Looking Statements
This Annual Report contains certain forward-looking statements (as such term is defined in Section 21E of the Securities
Exchange Act of 1934, as amended, or the Exchange Act) concerning future events and our operations, performance and financial
condition, including, in particular, the likelihood of our success in developing and expanding our business. Statements that are
predictive in nature, that depend upon or refer to future events or conditions, or that includHZRUGVVXFKDV³H[SHFWV´³DQWLFLSDWHV´
³LQWHQGV´³SODQV´³EHOLHYHV´³HVWLPDWHV´³SURMHFWV´³IRUHFDVWV´³ZLOO´³PD\´³SRWHQWLDO´³VKRXOG´DQGVLPLODUH[SUHVVions are
forward-looking statements. ThesHIRUZDUGORRNLQJVWDWHPHQWVUHIOHFWPDQDJHPHQW¶Vcurrent views only as of the date of this Annual
Report and are not intended to give any assurance as to future results. As a result, unitholders are cautioned not to rely on any forward-
looking statements.
Forward-looking statements appear in a number of places in this Annual Report and include statements with respect to, among
other things:
d FSRU and LNG market trends, including charter rates, factors affecting supply and demand, and opportunities for the
profitable operations of FSRUs and LNG carriers;
d RXUDQG*RODU¶VDELOLW\WRUHWUofit vessels as FSRUs and the timing of the delivery and acceptance of any such retrofitted
vessels, including with respect to the Nusantara Regas Satu (formerly named Khannur);
d our anticipated growth strategies;
d the effect of the worldwide economic slowdown;
d turmoil in the global financial markets;
d fluctuations in currencies and interest rates;
d general market conditions, including fluctuations in charter hire rates and vessel values;
d changes in our operating expenses, including drydocking and insurance costs and bunker prices;
i
d forecasts of our ability to make cash distributions on the units or any increases in our cash distributions;
d our future financial condition or results of operations and our future revenues and expenses;
d the repayment of debt and settling of interest rate swaps;
d our ability to make additional borrowings and to access debt and equity markets;
d planned capital expenditures and availability of capital resources to fund capital expenditures;
d our ability to maintain long-term relationships with major LNG traders;
d RXUDELOLW\WROHYHUDJH*RODU¶VUHODWLRQVKLSVDQGUHSXWDWLRQLQWKHVKLSSLQJLQGXVWU\
d our ability to realize the expected benefits from acquisitions;
d our ability to purchase vessels from Golar in the future, including the Nusantara Regas Satu;
d our continued ability to enter into long-term time charters, including charters for floating storage and regasification
projects;
d our ability to maximize the use of our vessels, including the re-deployment or disposition of vessels no longer under long-
term time charter;
d timely purchases and deliveries of newbuilding vessels;
d future purchase prices of newbuildings and secondhand vessels;
d our ability to compete successfully for future chartering and newbuilding opportunities;
d acceptance of a vessel by its charterer;
d termination dates and extensions of charters;
d the expected cost of, and our ability to comply with, governmental regulations, maritime self-regulatory organization
standards, as well as standard regulations imposed by our charterers applicable to our business;
d availability of skilled labor, vessel crews and management;
d our anticipated incremental general and administrative expenses as a publicly traded limited partnership and our fees and
expenses payable under the fleet management agreements and the management and administrative services agreement;
d the anticipated taxation of our partnership and distributions to our unitholders;
d estimated future maintenance and replacement capital expenditures;
d our ability to retain key employees;
d FXVWRPHUV¶LQFUHDVLQJHPSKDVLVRQenvironmental and safety concerns;
d potential liability from any pending or future litigation;
d potential disruption of shipping routes due to accidents, political events, piracy or acts by terrorists;
d future sales of our common units in the public market;
d our business strategy and other plans and objectives for future operations; and
d other factors detailed in this Annual Report and from time to time in our periodic reports.
Forward-looking statements in this Annual Report are estimates reflecting the judgment of senior management and involve
known and unknown risks and uncertainties. These forward-looking statements are based upon a number of assumptions and estimates
that are inherently subject to significant uncertainties and contingencies, many of which are beyond our control. Actual results may
differ materially from those expressed or implied by such forward-looking statements. Accordingly, these forward-looking statements
should be considered in light ofYDULRXVLPSRUWDQWIDFWRUVLQFOXGLQJWKRVHVHWIRUWKLQWKLV$QQXDO5HSRUWXQGHUWKHKHDGLQJ³,WHP²
KH\,QIRUPDWLRQ²5LVN)DFWRUV´
We do not intend to revise any forward-looking statements in order to reflect any change in our expectations or events or
circumstances that may subsequently arise. We make no prediction or statement about the performance of our common units. The
various disclosures included in this Annual Report and in our other filings made with the Securities and Exchange Commission (or the
SEC) that attempt to advise interested parties of the risks and factors that may affect our business, prospects and results of operations
should be carefully reviewed and considered.
PART I
Item 1. Identity of Directors, Senior Management and Advisers
Not applicable.
Item 2. Offer Statistics and Expected Timetable
Not applicable.
Item 3. Key Information
A. Selected Financial Data
The following table presents, in each case for the periods and as of the dates indicated, our selected consolidated and combined
financial and operating data, which includes, for periods prior to the completion of ouULQLWLDOSXEOLFRIIHULQJ³,32´RQ$Sril 13,
2011, certain subsidiaries of Golar that had interests in the vessels in our initial fleet, the *RODU:LQWHU, the *RODU6SLULW, the 0HWKDQH
3ULQFHVV and the *RODU0D]R. The transfers and contributions of the subsidiaries that had interests in the vessels in our initial fleet were
deemed to be a reorganization of entities under common control. As a result, these transactions have been recorded by the Partnership
DW*RODU¶VKLVWRULFDOERRNYDOXHV
In addition, in October 2011, we acquired from Golar interests in subsidiaries that own and operate the FSRU, the *RODU
)UHH]H. This transaction was also deemed to be a reorganization of entities under common control. As a result, our financial statements
have been retroactively adjusted to include the results of the *RODU)UHH]H. The periods retroactively adjusted include all periods that
we and the *RODU)UHH]H were both under the common control of Golar. As a result, the consolidated and combined statements of
operations of Golar LNG Partners for the years ended December 31, 2011, 2010, 2009, 2008 and 2007 reflect the results of operations
of the *RODU)UHH]H, referred to herein as the Dropdown Predecessor, as if we had acquired the *RODU)UHH]H when the vessel began
operations under the ownership of Golar.
The consolidated and combined financial data of Golar LNG Partners as of December 31, 2011 and 2010 and for the years
ended December 31, 2011, 2010 and 2009 are derived from the audited consolidated and combined financial statements of Golar LNG
Partners, prepared in accordance with U.S. GAAP, which are included elsewhere in this Annual Report.
The following financial data should be reDGLQFRQMXQFWLRQZLWK³,WHP²2SHUDWLQJDQG)LQDQFLDO5HYLHZDQG3URVSHFWV´DQG
our historical consolidated and combined financial statements and the notes thereto included elsewhere in this Annual Report.
Our financial position, results of operations and cash flows could differ from those that would have resulted if we operated
autonomously or as an entity independent of Golar in the periods prior to our IPO for which historical financial data are presented
below, and such data may not be indicative of our future operating results or financial performance.
Income Statement Data:
Total operating revenues
Vessel operating expenses(1)
Voyage expenses(2)
Administrative expenses
Depreciation and amortization
Impairment of long-term assets
Gain on sale of long-term assets
Total operating expenses
Operating income
2011
Year Ended December 31,
2008
2009
(in thousands except fleet data and per day data)
2010
2007
$ 203,725 $ 182,540 $ 126,634
29,762
4,909
5,040
28,238
1,500
²
69,449
57,185
33,069
238
5,203
35,634
²
²
74,144
129,581
32,505
1,950
5,591
33,068
1,500
²
74,614
107,926
$ 115,039 $ 104,418
22,023
24,398
3,253
6,364
7,025
6,134
26,233
24,924
2,345
109
(430)
²
60,879
61,499
43,539
53,540
1
Interest income
Interest expense
Other financial items, net
Income (loss) before income taxes and non-controlling
interest
Income taxes
Income (loss) before non-controlling interest
Non-controlling interest
Net income (loss) attributable to Golar LNG Partners
owners
Balance Sheet Data (at end of period):
Cash and cash equivalents
Restricted cash and short-term investments(3)
Long-term restricted cash(3)
Vessels, net
Vessels under capital lease, net(4)
Total assets
Current portion of long-term debt
Current portion of obligations under capital leases
Long-term debt
Long-term obligations under capital leases(4)
Non-controlling interest(5)
Owner¶VDQG'URSGRZQ3Uedecessor equity(6)
Partner¶VFDSLWDO
Cash Flow Data:
Net cash provided by operating activities
Net cash (used in) provided by investing activities
Net cash (used in) provided by financing activities
Fleet Data:
Number of vessels at end of period(7)
Average number of vessels during period(7)
Average age of vessels
Total calendar days for fleet
Total operating days for fleet(8)
Other Financial Data:
Average daily time charter equivalent earnings (TCE)(9)
Average daily vessel operating expenses(10)
2011
$ 1,547
(19,880)
2010
Year Ended December 31,
2008
2009
(in thousands except fleet data and per day data)
$ 25,470
$ 7,173
$ 3,388
(27,306) (49,482)
(17,952)
$ (20,115) $ (20,629) $ 16,764
(62,096)
$ (49,869) $ (6,002)
2007
$ 31,191
72,733
91,133
(20,341)
$ (1,609) $ (1,122) $ (1,640) $ 751
(19,590)
6,632
933
7,565
$ (9,863) $ (9,250) $ (9,012) $ (6,705) $ (6,547)
53,816
71,611
89,524
52,176
$
$ 79,661
$ 62,361
$ 43,164
$ (26,295) $ 1,018
$ 45,962
24,512
140,262
481,882
371,173
1,075,495
49,906
3,240
572,978
264,840
62,934
²
32,069
$ 44,100
21,815
140,970
505,039
383,695
1,135,893
47,390
3,113
400,574
268,380
55,470
219,790
²
$ 27,869
29,405
348,883
181,029
705,409
1,313,235
72,819
3,837
329,814
494,717
49,340
263,001
²
$ 24,643
30,883
330,121
184,425
584,989
1,183,053
39,906
2,606
367,633
450,487
41,688
141,828
²
$ 20,671
37,719
491,123
190,532
473,836
1,263,924
45,150
3,393
356,373
616,601
36,983
130,484
²
$ 150,303 $ 82,330 $ 61,832
(3,544) 170,941
(144,897) (237,040)
$ 16,620 $ 37,662
(46,821)
19,856
(123,730) (66,972)
54,324
65,124
5
5
18
1,825
1,818
5
5
17
1,825
1,690
5
5
16
1,825
1,412
5
5
15
1,830
1,541
111,500
18,120
106,858
17,811
83,488
16,308
70,522
13,332
5
5
14
1,825
1,424
60,110
12,067
(1) Vessel operating expenses are the direct costs associated with operating a vessel, including crew wages, vessel supplies, routine
repairs, maintenance, insurance, lubricating oils and management fees.
(2) All of our vessels have been operated under time charters during the periods presented. Under a time charter, the charterer pays
substantially all of the vessel voyage expenses, which are primarily fuel and port charges. However, we may incur voyage
related expenses when positioning or repositioning vessels before or after the period of a time charter, during periods of
commercial waiting time or while off-hire during a period of drydocking.
(3) Restricted cash and short-term investments consist of bank deposits, which may only be used to settle the *RODU0D]R and the
*RODU)UHH]H loans or lease payments in respect of the *RODU6SLULWor the *RODU)UHH]H(prior to December 2010)and the
0HWKDQH3ULQFHVV.
(4) During the periods presented, the *RODU6SLULW, the *RODU)UHH]H, the *RODU:LQWHU and the 0HWKDQH3ULQFHVV were subject to
lease financing arrangements, which are classified as capital leases. Under the arrangements for the *RODU6SLULWthe*RODU
)UHH]H and the 0HWKDQH3ULQFHVV, we borrowed under term loans and deposited the proceeds into restricted cash accounts.
Concurrently therewith, we entered into capital leases for the vessels, and the vessels were recorded as assets on our balance
sheet. These restricted cash deposits, plus the interest earned on the deposits, approximate the remaining amounts we owe under
the capital lease arrangements. Where movements in interest rates result in a surplus, this is released to working capital.
Similarly, where a deficit arises, this is funded through working capital. In these instances, we consider payments under our
capital leases to be funded through our restricted cash deposits, and our continuing obligation is the repayment of the term
loans. During December 2010, the outstanding lease liabilities on the *RODU6SLULW and the *RODU)UHH]H were repaid from the
associated restricted cash deposits. Under U.S. GAAP, we record both the obligations under the capital leases and the term
loans as liabilities, and both the restricted cash deposits and our vessels under capital leases as assets. This accounting treatment
has the effect of increasing both our assets and liabilities by the amount of restricted cash deposits relating to the corresponding
capital lease obligations. As of December 31, 2011, our total assets included restricted cash deposits of $164.8 million and our
total debt was gross of restricted cash deposits of the same amount.
(5) Non-controlling interest refers to a 40% interest in the *RODU0D]R owned by Chinese Petroleum Corporation.
2
(6) 7KH3DUWQHUVKLS¶VEDODQFHVKHHWDVDW'HFHPber 31, 2010 has been retroactively adjusted to include the assets and liabilities
relating to the *RODU)UHH]H. Equity relating to the *RODU)UHH]Hfor periods prior to the acquisition of the *RODU)UHH]Hby the
Partnership (on October 19, 2011), when the *RODU)UHH]Hwas owned and operated by Golar, are referred to as the Dropdown
Predecessor equity.
(7) In each of the periods presented, we held (or are deemed to have held) a 60% ownership interest in the *RODU0D]R and a 100%
interest in our four other vessels.
(8) The operating days for our fleet is the total number of days in a given period that the vessels were in our possession less the total
number of days off-hire. We define days off-hire as days lost to, among other things, operational deficiencies, drydocking for
repairs, maintenance or inspection, equipment breakdowns, special surveys and vessel upgrades, delays due to accidents,
crewing strikes, certain vessel detentions or similar problems, or our failure to maintain the vessel in compliance with its
specifications and contractual standards or to provide the required crew, or during periods of commercial waiting time during
which we do not earn charter hire.
(9) Non-GAAP Financial Measures
7&(It is standard industry practice to measure the revenue performance of a vessel in terms of average daily TCE. For time
charters, this is calculated by dividing total operating revenue less voyage expenses by the number of calendar days minus days
for scheduled off-hire. Where we are paid a fee to position or reposition a vessel before or after a time charter, this additional
revenue, less voyage expenses, is included in the calculation of net time charter revenues. The following table reconciles our
total operating revenues to average daily TCE.
Total operating revenues
Voyage expenses
Calendar days less scheduled off-hire days
Average daily TCE (in $)
2011
$ 203,725
(238)
Year Ended December 31,
2008
2010
2009
(in thousands, except average daily TCE)
$ 115,039
$ 126,634
(4,909) (6,364)
$ 182,540
(1,950)
2007
$ 203,487 $ 180,590 $ 121,725
1,458
$ 83,488
1,690
$ 106,858
1,825
$ 111,500
$ 104,418
(3,253)
$ 108,675 $ 101,165
1,683
$ 60,110
1,541
$ 70,522
(10) We calculate average daily vessel operating expenses by dividing vessel operating expenses by the number of calendar days.
B. Capitalization and Indebtedness
Not applicable.
C. Reasons for the Offer and Use of Proceeds
Not applicable.
D. Risk Factors
Some of the following risks relate principally to the industry in which we operate and to our business in general. Other risks
relate principally to the securities market and to ownership of our common units. The occurrence of any of the events described in this
section could significantly and negatively affect our business, financial condition, operating results or cash available for distributions or
the trading price of our common units.
Risks Inherent in Our Business
We will be required to make substantial capital expenditures to expand the size of our fleet. Depending on whether we finance
our expenditures through cash from operations or by issuing debt or equity securities, our ability to make cash distributions
may be diminished, our financial leverage could increase or our unitholders could be diluted.
We will be required to make substantial capital expenditures to expand the size of our fleet. We may be required to make
significant installment payments for retrofitting of LNG carriers to FSRUs and acquisitioQVRI/1*FDUULHUVDQG)658¶V:HDQG
Golar regularly evaluate and pursue opportunities to provide floating LNG storage and regasification services and LNG transportation
for new or expanding LNG projects. Upon our expected purchase of the 1XVDQWDUD5HJDV 6DWX, or if we choose to purchase any other
FSRUs or LNG carriers (either from Golar or independently), we plan to finance the cost either through cash from operations,
borrowings or debt or equity financings.
3
Use of cash from operations to expand our fleet will reduce cash available for distribution to unitholders. Our ability to obtain
bank financing or to access the capital markets may be limited by our financial condition at the time of any such financing or offering
as well as by adverse market conditions resulting from, among other things, general economic conditions, changes in the LNG industry
and contingencies and uncertainties that are beyond our control. Our failure to obtain the funds for future capital expenditures could
have a material adverse effect on our business, results of operations and financial condition and on our ability to make cash
distributions. Even if we are successful in obtaining necessary funds, the terms of any debt financings could limit our ability to pay
cash distributions to unitholders. In addition, incurring additional debt may significantly increase our interest expense and financial
leverage, and issuing additional equity securities may result in significant unitholder dilution and would increase the aggregate amount
of cash required to pay the minimum quarterly distribution to unitholders, which could have a material adverse effect on our ability to
make cash distributions.
We have no ability to borrow additional amounts under our revolving credit facility. If we are unable to obtain additional
financing, we may be unable to meet our obligations as they come due, enhance our existing business, complete acquisitions,
respond to competitive pressures or otherwise execute our growth strategy.
Other than our $20 million undrawn sponsor credit facility with Golar, we have no other available borrowing capacity as of
April 20, 2012. We have no ability to borrow additional amounts under our Golar LNG Partners revolving credit facility. Therefore,
we will be required to obtain additional financing in order to fund the expansion of our fleet beyond its current size.
We plan to finance our future acquisitions through cash from operations, borrowings or debt or equity financings. Use of cash
from operations to expand our fleet will reduce cash available for distribution to unitholders. Our ability to obtain bank financing or to
access the capital markets may be limited by our financial condition at the time of any such financing or offering as well as by adverse
market conditions resulting from, among other things, general economic conditions, changes in the LNG industry and contingencies
and uncertainties that are beyond our control. Our failure to obtain the funds for future capital expenditures could have a material
adverse effect on our business, results of operations and financial condition and our ability to make cash distributions.
Even if we are successful in obtaining necessary funds, the terms of any debt financings could limit our ability to pay cash
distributions to unitholders. In addition, incurring additional debt may increase our interest expense and financial leverage, and issuing
additional equity securities may result in unitholder dilution and would increase the aggregate amount of cash required to pay the
minimum quarterly distribution to unitholders, which could have a material adverse effect on our ability to make cash distributions.
We depend on certain affiliates of Golar, including Golar Management and Golar Wilhelmsen, to assist us in operating and
expanding our business and providing interim financing for certain vessel acquisitions.
Our ability to enter into new charters and expand our customer relationships will depend largely on our ability to leverage our
relationship with Golar and its reputation and relationships in the shipping industry. If Golar suffers material damage to its reputation
or relationships, it may harm our ability to:
d renew existing charters upon their expiration;
d obtain new charters;
d successfully interact with shipyards;
d obtain financing on commercially acceptable terms;
d maintain access to capital under the sponsor credit facility; or
d maintain satisfactory relationships with suppliers and other third parties.
Golar is also incurring all costs for the construction and delivery of certain newbuildings. We will have the option to purchase
from Golar all of their newbuildings upon delivery of the newbuildings and entry into long term
4
charters. If Golar fails to make construction payments for these newbuildings, we could lose the ability to purchase these vessels as a
result of such default, which could harm our business and reduce our ability to make cash distributions.
In addition, each vessel in our fleet is subject to management agreements pursuant to which certain commercial and technical
management services are provided by certain affiliates of Golar, including Golar Management and Golar Wilhelmsen. Pursuant to
these agreements, these entities provide significant commercial and technical management services for our fleet. In addition, pursuant
to a management and administrative services agreement between us and Golar Management, Golar Management provides us with
significant management, administrative, financial and other support services. Our operational success and ability to execute our growth
strategy depends significantly upon the satisfactory performance of these services. Our business will be harmed if our service providers
fail to perform these services satisfactorily, if they cancel their agreements with us or if they stop providing these services to us. Please
UHDG³,WHP²0DMRU8QLWKROGHUVDQG5HODWHG3DUW\7UDQVDFWLRQV²5HODWHG3DUW\7UDQVDFWLRQV´
We may not have sufficient cash from operations following the establishment of cash reserves and payment of fees and
expenses to enable us to pay the minimum quarterly distribution on our common units and subordinated units.
We may not have sufficient cash from operations to pay the minimum quarterly distribution of $0.3850 per unit on our
common units and subordinated units. The amount of cash we can distribute on our units principally depends upon the amount of cash
we generate from our operations, which may fluctuate from quarter to quarter based on the risks described in this section, including,
among other things:
d the rates we obtain from our charters;
d the level of our operating costs, such as the cost of crews and insurance;
d the continued availability of natural gas production, liquefaction and regasification facilities;
d demand for LNG;
d supply of LNG carriers;
d prevailing global and regional economic and political conditions;
d currency exchange rate fluctuations; and
d the effect of governmental regulations and maritime self-regulatory organization standards on the conduct of our business.
In addition, the actual amount of cash available for distribution to our unitholders will depend on other factors, including:
d the level of capital expenditures we make, including for maintaining or replacing vessels, building new vessels, acquiring
existing vessels and complying with regulations;
d the number of unscheduled off-hire days for our fleet and the timing of, and number of days required for, scheduled
drydocking of our vessels;
d our debt service requirements and restrictions on distributions contained in our debt instruments;
d the level of debt we will incur to fund future acquisitions, including if we exercise our option to purchase the 1XVDQWDUD
5HJDV6DWX from Golar;
d fluctuations in interest rates;
5
d fluctuations in our working capital needs;
d variable tax rates;
d our ability to make, and the level of, working capital borrowings; and
d the amount of any cash reserves established by our board of directors.
The amount of cash we generate from our operations may differ materially from our profit or loss for the period, which will be
affected by non-cash items. As a result of this and the other factors mentioned above, we may make cash distributions during periods
when we record losses and may not make cash distributions during periods when we record net income.
We must make substantial capital expenditures to maintain and replace the operating capacity of our fleet, which will reduce
our cash available for distribution. In addition, each quarter we are required to deduct estimated maintenance and replacement
capital expenditures from operating surplus, which may result in less cash available to unitholders than if actual maintenance
and replacement capital expenditures were deducted.
We must make substantial capital expenditures to maintain and replace, over the long-term, the operating capacity of our fleet.
Maintenance and replacement capital expenditures include capital expenditures associated with drydocking a vessel, modifying an
existing vessel, acquiring a new vessel or otherwise replacing current vessels at the end of their useful lives to the extent these
expenditures are incurred to maintain or replace the operating capacity of our fleet. These expenditures could vary significantly from
period to period and could increase as a result of changes in:
d the cost of labor and materials;
d customer requirements;
d fleet size;
d the cost of replacement vessels;
d length of charters;
d governmental regulations and maritime self-regulatory organization standards relating to safety, security or the
environment; and
d competitive standards.
Our partnership agreement requires our board of directors to deduct estimated maintenance and replacement capital
expenditures, instead of actual maintenance and replacement capital expenditures, from operating surplus each quarter in an effort to
reduce fluctuations in operating surplus as a result of significant variations in actual maintenance and replacement capital expenditures
each quarter. The amount of estimated maintenance and replacement capital expenditures deducted from operating surplus is subject to
review and change by our conflicts committee at least once a year. In years when estimated maintenance and replacement capital
expenditures are higher than actual maintenance and replacement capital expenditures, the amount of cash available for distribution to
unitholders will be lower than if actual maintenance and replacement capital expenditures were deducted from operating surplus. If our
board of directors underestimates the appropriate level of estimated maintenance and replacement capital expenditures, we may have
less cash available for distribution in periods when actual capital expenditures exceed our previous estimates.
Specifically, we have agreed to make certain modifications to the *RODU:LQWHUDVDUHVXOWRI3HWUREUDV¶VGHFLVLRQWRUHORFDWH
the *RODU:LQWHU, from Rio de Janeiro to Bahia. We expect to enter into an agreement with Golar, under which Golar will undertake
the modification work, which began with the ordering of long lead items together in the first quarter of 2012 and is expected to be
completed by the third quarter of 2013. We currently
6
expect the cost of these modifications together with drydocking costs to be approximately $25 million, which we expect to fund with a
combination of cash and undrawn credit facilities or future debt or equity transactions.
We may be unable to make or realize expected benefits from acquisitions, including our potential future acquisition of the
Nusantara Regas Satu, which could have an adverse effect on our expected plans for growth.
Our growth strategy includes selectively acquiring FSRUs and LNG carriers that are operating under long-term, stable cash
flow generating time charters. For instance, in October 2011, we completed the acquisition of the *RODU)UHH]H from Golar for a
purchase price of $330 million. Under the omnibus agreement that we entered into in connection with our initial public offering, we
have the right to purchase the 1XVDQWDUD5HJDV6DWXIURP*RODUDIWHUFRPSOHWLRQRIWKHYHVVHO¶VUHWURILWWLQJDQGDFFHSWDQFHE\LWV
charterer, which is expected to occur in 2012, at a price equal to its fair market value, as determined pursuant to the omnibus agreement.
We may not exercise our option to acquire the 1XVDQWDUD5HJDV6DWX if such price is an amount that is greater than what we are able or
willing to pay. We will not be obligated to purchase the 1XVDQWDUD5HJDV6DWX at the determined price, and, accordingly, we may not
complete the purchase if, among other things, the acquisition of such vessel would not be accretive to our cash available for distribution
or if our view of the market for FSRUs changes. If we are unable to purchase the 1XVDQWDUD5HJDV6DWX, our expected future business,
financial condition and results of operations may be adversely affected.
Furthermore, any acquisition of a vessel or business may not be profitable to us at or after the time we acquire it and may not
generate cash flow sufficient to justify our investment. In addition, our acquisition growth strategy exposes us to risks that may harm
our business, financial condition and operating results, including risks that we may:
d fail to realize anticipated benefits, such as new customer relationships, cost-savings or cash flow enhancements;
d be unable to hire, train or retain qualified shore and seafaring personnel to manage and operate our growing business and
fleet;
d decrease our liquidity by using a significant portion of our available cash or borrowing capacity to finance acquisitions;
d significantly increase our interest expense or financial leverage if we incur additional debt to finance acquisitions;
d incur or assume unanticipated liabilities, losses or costs associated with the business or vessels acquired; or
d incur other significant charges, such as impairment of goodwill or other intangible assets, asset devaluation or
restructuring charges.
Unlike newbuildings, existing vessels typically do not carry warranties as to their condition. While we generally inspect
existing vessels prior to purchase, such an inspection would normally not provide us wLWKDVPXFKNQRZOHGJHRIDYHVVHO¶VFRQGLtion as
we would possess if it had been built for us and operated by us during its life. Repairs and maintenance costs for existing vessels are
difficult to predict and may be substantially higher than for vessels we have operated since they were built. These costs could decrease
our cash flow and reduce our liquidity and could have an adverse effect on our expected plans for growth.
The required drydocking of our vessels could be more expensive and time consuming than we anticipate, which could adversely
affect our cash available for distribution.
The drydocking of our vessels requires significant capital expenditures and results in loss of revenue while our vessels are off-
hire. Any significant increase in the number of days of off-hire due to such drydocking or in the costs of any repairs could have a
material adverse effect on our ability to pay distributions to our unitholders. Although we do not anticipate that more than one of our
vessels will be out of service at any given time, we may
7
underestimate the time required to drydock any of our vessels or unanticipated problems may arise. If more than one of our vessels is
required to be out of service at the same time, if a vessel is drydocked longer than expected or if the cost of repairs during drydocking is
greater than budgeted, our cash available for distribution could be adversely affected.
Our growth depends on continued growth in demand for LNG, FSRUs and LNG carriers.
Our growth strategy focuses on expansion in the floating storage and regasification sector and the LNG shipping sector. While
global LNG demand has continued to rise, the rate of its growth has fluctuated due to several reasons, including the global economic
crisis and the continued increase in natural gas production from unconventional sources in regions such as North America.
Accordingly, our growth depends on continued growth in world and regional demand for LNG, FSRUs and LNG carriers, which could
be negatively affected by a number of factors, including:
d increases in the cost of natural gas derived from LNG relative to the cost of natural gas generally;
d increases in the production levels of low-cost natural gas in domestic natural gas consuming markets, which could further
depress prices for natural gas in those markets and make LNG uneconomical;
d decreases in the cost, or increases in the demand for, conventional land-based regasification systems, which could occur if
providers or users of regasification services seek greater economies of scale than FSRUs can provide or if the economic,
regulatory or political challenges associated with land-based activities improve;
d further development of, or decreases in the cost of, alternative technologies for vessel-based LNG regasification;
d increases in the production of natural gas in areas linked by pipelines to consuming areas, the extension of existing, or the
development of new, pipeline systems in markets we may serve, or the conversion of existing non-natural gas pipelines to
natural gas pipelines in those markets;
d decreases in the consumption of natural gas due to increases in its price relative to other energy sources or other factors
making consumption of natural gas less attractive;
d availability of new, alternative energy sources, including compressed natural gas; and
d negative global or regional economic or political conditions, particularly in LNG consuming regions, which could reduce
energy consumption or its growth.
Reduced demand for LNG, FSRUs or LNG carriers would have a material adverse effect on our future growth and could harm
our business, results of operations and financial condition.
We have only five vessels in our fleet. Any limitation on the availability or operation of those vessels could have a material
adverse effect on our business, results of operations and financial condition and could significantly reduce our ability to make
distributions to our unitholders.
Our current fleet currently consists of three FSRUs and two LNG carriers. If any of our FSRUs or LNG carriers are unable to
generate revenues as a result of off-hire time, our results of operations and financial condition could be materially adversely affected.
The charters relating to our FSRUs and LNG carriers permit the charterer to terminate the charter in the event that the vessel is
off-hire for any extended period. The charters also allow each charterer to terminate the charter upon the occurrence of specified
defaults by us. The termination of any of our charters could have a material adverse effect on our business, results of operations and
financial condition and could significantly reduce our ability to make distributions to our unitholders if we are unable to re-charter such
vessel for an extended period of time. For further details regarding termination of our charWHUVSOHDVHUHDG³,WHP²,QIRUPDWion on
WKH3DUWQHUVKLS²%XVLQHVV2YHUYLHZ²)658&KDUWHUV´DQG³²/1*&DUULHU&KDUWHUV´
8
We currently derive all of our revenue from four customers. The loss of any of these customers would result in a significant
loss of revenues and cash flow, if for an extended period of time, we are not able to re-charter a vessel to another customer.
We have derived, and believe that we will continue to derive, all of our revenues and cash flow from a limited number of
customers. For the year ended December 31, 2011, BG Group PLC (or BG Group) accounted for 12%, PT Pertamina (PERSERO) (or
Pertamina) accounted for 19%, Dubai Supply Authority accounted for 23% and Petrobras accounted for 46% of our total revenues,
respectively. All of our charters have fixed terms, but might nevertheless be lost in the event of unanticipated developments such as a
FXVWRPHU¶VEUHDFK
We could also lose a customer or the benefits of a charter if:
d the customer fails to make charter payments because of its financial inability, disagreements with us or otherwise;
d the customer exercises its right to terminate the charter in certain circumstances, such as:
d loss of the vessel or damage to it beyond repair;
d defaults of our obligations under the charter, including prolonged periods of off-hire;
d in the event of war or hostilities that would significantly disrupt the free trade of the vessel;
d requisition by any governmental authority; or
d with respect to the *RODU6SLULW, the *RODU:LQWHU and the *RODU)UHH]HXSRQVL[PRQWKV¶ZULWWHQQRWLFHDWDQ\WLPH
after the fifth anniversary of the commencement of the related charter upon payment of a termination fee;
d a prolonged force majeure event affecting the customer, including damage to or destruction of relevant production
facilities, war or political unrest prevents us from performing services for that customer.
If we lose any of our charters and are unable to re-deploy the related vessel on terms as favorable to us as our current charters
for an extended period of time, we will not receive any revenues from that vessel, but we may be required to pay expenses necessary to
maintain the vessel in proper operating condition. The loss of any of our customers, charters or vessels, or a decline in payments under
any of our charters, could have a material adverse effect on our business, results of operations, financial condition and ability to make
cash distributions to our unitholders, if we are not able to re-charter a vessel to another customer for an extended period of time.
Our debt levels may limit our flexibility in obtaining additional financing, pursuing other business opportunities and paying
distributions to unitholders.
As of December 31, 2011, we had a total consolidated debt (including capitalized lease obligations, net of restricted cash, and
including indebtedness outstanding under our credit facilities) of approximately $726 million. In addition, we have the ability to incur
additional debt. Our level of debt could have important consequences to us, including the following:
d our ability to obtain additional financing, if necessary, for working capital, capital expenditures, acquisitions or other
purposes may be limited or such financing may not be available on favorable terms;
d we will need a substantial portion of our cash flow to make principal and interest payments on our debt, reducing the
funds that would otherwise be available for operations, future business opportunities and distributions to unitholders;
d our debt level will make us more vulnerable than our competitors with less debt to competitive pressures or a downturn in
our business or the economy generally; and
d our debt level may limit our flexibility in responding to changing business and economic conditions.
9
Our ability to service our debt will depend upon, among other things, our future financial and operating performance, which
will be affected by prevailing economic conditions and financial, business, regulatory and other factors, some of which are beyond our
control. If our operating results are not sufficient to service our current or future indebtedness, we will be forced to take actions such as
reducing distributions, reducing or delaying our business activities, acquisitions, investments or capital expenditures, selling assets,
restructuring or refinancing our debt, or seeking additional equity capital or bankruptcy protection. We may not be able to effect any of
these remedies on satisfactory terms, or at all.
Our financing arrangements are secured by our vessels and contain operating and financial restrictions and other covenants
that may restrict our business and financing activities as well as our ability to make cash distributions to our unitholders.
The operating and financial restrictions and covenants in our financing arrangements, including the Golar LNG Partners credit
facility, our lease agreements and any future financing agreements, such as the *RODU)UHH]H credit facility, could adversely affect our
ability to finance future operations or capital needs or to engage, expand or pursue our business activities. For example, subject to
certain exceptions, the Golar LNG Partners credit facility, which is secured by a first priority charge over the 0HWKDQH3ULQFHVV and the
*RODU6SLULW and a second priority charge over the *RODU0D]R, requires the prior written consent of our lenders or otherwise restricts
RXUDQGRXUVXEVLGLDULHV¶DEility to, among other things:
d merge or consolidate with any other person;
d make certain capital expenditures;
d pay distributions to our unitholders;
d terminate or materially amend certain of our charters;
d enter into any other line of business;
d make any acquisitions;
d incur additional indebtedness or grant any liens to secure any of our existing or future indebtedness;
d enter into any sale-leaseback transactions; or
d enter into any transactions with our affiliates.
In addition, the Golar LNG Partners credit facility prohibits us from paying distributions to our unitholders if we are not in
compliance with certain financial covenants or upon the occurrence of an event of default. The agreements governing our other
financing arrangements, including the sponsor credit facility, the loan facility with respect to the *RODU0D]R (or the Mazo credit
facility), the $108 million credit facility that we assumed in connection with our acquisition of the *RODU)UHH]H (or the *RODU)UHH]H
Facility), the $222 million loan from Golar that we entered into in connection with our acquisition of the *RODU)UHH]H (or the *RODU
)UHH]H vendor loan), and our lease agreements also contain operating and financial restrictions and covenants. For more information,
UHJDUGLQJRXUILQDQFLDODUUDQJHPHQWVSOHDVHUHDG³,WHP²2SHUating and Financial Review and 3URVSHFWV²/LTXLGLW\DQG&DSLWDO
5HVRXUFHV²%RUURZLQJ$FWLYLWLHV²/RQJ7HUP'HEW´DQG³²&DSLWDO/HDVH2EOLJDWLRQV´
Our ability to comply with covenants and restrictions contained in our financing arrangements may be affected by events
beyond our control, including prevailing economic, financial and industry conditions. If market or other economic conditions
deteriorate, our ability to comply with these covenants may be impaired. If restrictions, covenants, ratios or tests in our debt
instruments are breached, a significant portion of the obligations may become immediately due DQGSD\DEOHDQGWKHOHQGHUV¶
commitment to make further loans may terminate. We may not have, or be able to obtain, sufficient funds to make these accelerated
payments. In addition, obligations under our financing arrangements are secured by certain of our vessels and guaranteed by our
subsidiaries holding the interests in our vessels, and if we are unable to repay debt under our financing arrangements, the lenders or
lessors could seek to foreclose on those assets.
10
As of December 31, 2011, we were in compliance with all the covenants under our various debt agreements, with the
exception of our consolidated net worth covenant under our Golar LNG Partners credit facility. In respect of this facility, we received a
waiver in March 2012 effective December 31, 2011. Please read ³,WHP²'HIDXOWVGLYLGHQGDUUHDUDJHVDQGGHOLQTXHQFLHV´IRU
further detail.
Growth of the LNG market may be limited by many factors, including infrastructure constraints and community and political
group resistance to new LNG infrastructure over concerns about the environment, safety and terrorism.
A complete LNG project includes production, liquefaction, regasification, storage and distribution facilities and LNG carriers.
Existing LNG projects and infrastructure are limited, and new or expanded LNG projects are highly complex and capital intensive, with
new projects often costing several billion dollars. Many factors could negatively affect continued development of LNG infrastructure
and related alternatives, including floating storage and regasification, or disrupt the supply of LNG, including:
d increases in interest rates or other events that may affect the availability of sufficient financing for LNG projects on
commercially reasonable terms;
d decreases in the price of LNG, which might decrease the expected returns relating to investments in LNG projects;
d the inability of project owners or operators to obtain governmental approvals to construct or operate LNG facilities;
d local community resistance to proposed or existing LNG facilities based on safety, environmental or security concerns;
d any significant explosion, spill or similar incident involving an LNG facility, FSRU or LNG carrier; and
d labor or political unrest affecting existing or proposed areas of LNG production and regasification.
We expect that, as a result of the factors discussed above, some of the proposals to expand existing or develop new LNG
liquefaction and regasification facilities may be abandoned or significantly delayed. If the LNG supply chain is disrupted or does not
continue to grow, or if a significant LNG explosion, spill or similar incident occurs, it could have a material adverse effect on our
business, results of operations and financial condition and our ability to make cash distributions.
Our growth depends on our ability to expand relationships with existing customers and obtain new customers, for which we will
face substantial competition.
One of our principal objectives is to enter into additional long-term, FSRU and LNG carrier time charters. The process of
obtaining long-term charters for FSRUs and LNG carriers is highly competitive and generally involves an intensive screening process
and competitive bids, and often extends for several months. We believe FSRU and LNG carrier time charters are awarded based upon
bid price as well as a variety of factors relating to the vessel operator, including:
d LNG shipping and FSRU experience, technical ability and reputation for operation of highly specialized vessels;
d shipping industry relationships and reputation for customer service and safety;
d quality and experience of seafaring crew;
d financial stability and the ability to finance FSRUs and LNG carriers at competitive rates;
d relationships with shipyards and construction management experience; and
11
d willingness to accept operational risks pursuant to the charter.
We expect substantial competition for providing floating storage and regasification services and marine transportation services
for potential LNG projects from a number of experienced companies, including state-sponsored entities and major energy companies.
Many of these competitors have significantly greater financial resources and larger and more versatile fleets than do we or Golar. We
anticipate that an increasing number of PDULQHWUDQVSRUWDWLRQFRPSDQLHV²LQFOXGLQJPDQ\ZLWKVWURQJUHSXWDWLRQVDQGH[WHQVLYH
UHVRXUFHVDQGH[SHULHQFH²ZLOOHQWHUWKH)658market and LNG transportation market. This increased competition may cause greater
price competition for time charters. As a result of these factors, we may be unable to expand our relationships with existing customers
or to obtain new customers on a profitable basis, if at all, which would have a material adverse effect on our business, results of
operations and financial condition and our ability to make cash distributions.
We may have more difficulty entering into long-term time charters in the future if an active short-term or spot LNG shipping
market continues to develop.
One of our principal strategies is to enter into additional long-term FSRU and LNG carrier time charters of five years or more.
Most shipping requirements for new LNG projects continue to be provided on a long-term basis, though the level of spot voyages and
short-term time charters of less than 12 months in duration has grown in the past few years.
If an active spot or short-term market continues to develop, we may have increased difficulty entering into long-term time
charters upon expiration or early termination of our current charters or for any vessels that we acquire in the future, and, as a result, our
cash flow may be less stable. In addition, an active short-term or spot LNG market may require us to enter into charters based on
changing market prices, as opposed to contracts based on a fixed rate, which could result in a decrease in our cash flow in periods when
the market price for shipping LNG is depressed or insufficient funds are available to cover our financing costs for related vessels.
Hire rates for FSRUs and LNG carriers are not readily available and may fluctuate substantially. If rates are lower when we
are seeking a new charter, our earnings and ability to make distributions to our unitholders may decline.
Hire rates for FSRUs and LNG carriers are not readily available and may fluctuate over time as a result of changes in the
supply-demand balance relating to current and future FSRU and LNG carrier capacity. This supply-demand relationship largely
depends on a number of factors outside our control. The LNG market is closely connected to world natural gas prices and energy
markets, which we cannot predict. A substantial or extended decline in natural gas prices could adversely affect our ability to recharter
our vessels at acceptable rates or to acquire and profitably operate new FSRUs or LNG carriers. Our ability from time to time to charter
or re-charter any vessel at attractive rates will depend on, among other things, the prevailing economic conditions in the LNG industry.
Hire rates for newbuilding FSRUs and LNG carriers are correlated with their purchase price. Hire rates at a time when we may be
seeking a new charter may be lower than the hire rates at which our vessels are currently chartered. If rates are lower when we are
seeking a new charter, our earnings and ability to make distributions to our unitholders may decline.
Vessel values may fluctuate substantially and, if these values are lower at a time when we are attempting to dispose of vessels,
we may incur a loss.
Vessel values for LNG carriers can fluctuate substantially over time due to a number of different factors, including:
d prevailing economic conditions in the natural gas and energy markets;
d a substantial or extended decline in demand for LNG;
d increases in the supply of vessel capacity;
d the size and age of a vessel; and
12
d the cost of retrofitting or modifying existing vessels, as a result of technological advances in vessel design or equipment,
changes in applicable environmental or other regulations or standards, customer requirements or otherwise.
As our vessels age, the expenses associated with maintaining and operating them are expected to increase, which could have
an adverse effect on our business and operations if we do not maintain sufficient cash reserves for maintenance and replacement capital
expenditures. Moreover, the cost of a replacement vessel would be significant.
If a charter terminates, we may be unable to re-deploy the affected vessels at attractive rates and, rather than continue to incur
costs to maintain and finance them, we may seek to dispose of them. Our inability to dispose of vessels at a reasonable value could
result in a loss on their sale and adversely affect our ability to purchase a replacement vessel, results of operations and financial
condition and ability to make distributions to unitholders.
Our insurance may be insufficient to cover losses that may occur to our property or result from our operations.
The operation of FSRUs and LNG carriers is inherently risky. Although we carry protection and indemnity insurance
consistent with industry standards, all risks may not be adequately insured against, and any particular claim may not be paid. Any
claims covered by insurance would be subject to deductibles, and since it is possible that a large number of claims may be brought, the
aggregate amount of these deductibles could be material. Certain of our insurance coverage is maintained through mutual protection
and indemnity associations, and as a member of such associations we may be required to make additional payments over and above
budgeted premiums if member claims exceed association reserves.
We may be unable to procure adequate insurance coverage at commercially reasonable rates in the future. For example, more
stringent environmental regulations have led in the past to increased costs for, and in the future may result in the lack of availability of,
insurance against risks of environmental damage or pollution. A marine disaster could exceed our insurance coverage, which could
harm our business, financial condition and operating results. Any uninsured or underinsured loss could harm our business and financial
condition. In addition, our insurance may be voidable by the insurers as a result of certain of our actions, such as our ships failing to
maintain certification with applicable maritime self-regulatory organizations.
Changes in the insurance markets attributable to terrorist attacks or piracy may also make certain types of insurance more
difficult for us to obtain. In addition, upon renewal or expiration of our current policies, the insurance that may be available to us may
be significantly more expensive than our existing coverage.
We may be subject to increased premium payments, or calls, if the value of our claim records, the claim records of our fleet
managers, and/or the claim records of other members of the protection and indemnity associations through which we receive insurance
coverage for tort liability (including pollution-related liability) significantly exceed projected claims. In addition, our protection and
indemnity associations may not have enough resources to cover claims made against them. Our payment of these calls could result in
significant expense to us, which could have a material adverse effect on our business, results of operations, cash flows, financial
condition and ability to pay distributions.
An increase in operating expenses or drydocking costs could materially and adversely affect our financial performance.
Our operating expenses and drydock capital expenditures depend on a variety of factors including crew costs, provisions, deck
and engine stores and spares, lubricating oil, insurance, maintenance and repairs and shipyard costs, many of which are beyond our
control and affect the entire shipping industry. Also, while we do not bear the cost of fuel (bunkers) under our time charters, fuel is a
significant expense in our operations when our vessels are, for example, moving to or from dry-dock or when off-hire. The price and
supply of fuel is unpredictable and fluctuates based on events outside our control, including geopolitical developments, supply and
demand for oil and gas, actions by OPEC and other oil and gas producers, war and unrest in oil-producing countries and regions,
regional production patterns and environmental concerns. These may increase vessel operating and drydocking costs further. If costs
continue to rise, they could materially and adversely affect our results of operations.
13
An increased shortage of qualified officers and crew could have an adverse effect on our business and financial condition.
FSRUs and LNG carriers require a technically skilled officer staff with specialized training. As the world FSRU fleet and
LNG carrier fleet continue to grow, the demand for technically skilled officers and crew has been increasing, which has led to a
shortfall of such personnel. Increases in our historical vessel operating expenses have been attributable primarily to the rising costs of
recruiting and retaining officers for our fleet. In addition, our FSRUs require an additional engineer, deck officer and cargo officer.
Furthermore, each key officer crewing an FSRU must receive specialized training related to the operation and maintenance of the
regasification equipment. If Golar Management or Golar Wilhelmsen are unable to employ technically skilled staff and crew, they will
not be able to adequately staff our vessels. A material decrease in the supply of technically skilled officers or an inability of Golar
Management or Golar Wilhelmsen to attract and retain such qualified officers could impair our ability to operate or increase the cost of
crewing our vessels, which would materially adversely affect our business, financial condition and results of operations and
significantly reduce our ability to make distributions to our unitholders.
In addition, the *RODU6SLULW and the *RODU:LQWHU are employed by Petrobras in Brazil. As a result, we are required to hire a
certain portion of Brazilian personnel to crew these vessels in accordance with Brazilian law. Any inability to attract and retain
qualified Brazilian crew members could adversely affect our business, results of operations and financial condition and could
significantly reduce our ability to make distributions to our unitholders.
We may be unable to attract and retain key management personnel in the LNG industry, which may negatively impact the
effectiveness of our management and our results of operation.
Our success depends to a significant extent upon the abilities and the efforts of our senior executives. While we believe that
we have an experienced management team, the loss or unavailability of one or more of our senior executives for any extended period of
time could have an adverse effect on our business and results of operations.
Exposure to currency exchange rate fluctuations will result in fluctuations in our cash flows and operating results.
Historically our revenue has been generated in U.S. Dollars, but we incur capital, operating and administrative expenses in
multiple currencies, including, among others, the Euro, the Brazilian Real and the British Pound. If the U.S. Dollar weakens
significantly, we would be required to convert more U.S. Dollars to other currencies to satisfy our obligations, which would cause us to
have less cash available for distribution. Under the charters and OSAs for the *RODU6SLULW and *RODU:LQWHU, we generate a portion of
our revenues in Brazilian Reais. We incur some operating expenses in Brazilian Reais but also have to convert Brazilian Reais into
other currencies in order to pay the remaining operating expenses. If the Brazilian Real weakens significantly, we may not have
sufficient Brazilian Reais to convert to other currencies to satisfy our obligations in respect of the operating expenses related to these
charters, which would cause us to have less cash available for distribution. In addition, although the majority of our British Pound
capital lease obligations are hedged by British Pound cash deposits securing the lease obligations or currency swaps, these are not
perfect hedges. Although it would not affect our cash flows, a significant strengthening of the U.S. Dollar could result in an increase in
our financial expenses and could materially affect our financial results under U.S. GAAP.
Because we report our operating results in U.S. Dollars, changes in the value of the U.S. Dollar also result in fluctuations in
our reported revenues and earnings. In addition, under U.S. GAAP, all foreign currency-denominated monetary assets and liabilities
such as cash and cash equivalents, accounts receivable, restricted cash, accounts payable, long-term debt and capital lease obligations
are revalued and reported based on the prevailing exchange rate at the end of the reporting period. This revaluation may cause us to
report significant non-monetary foreign currency exchange gains and losses in certain periods.
14
Two of our vessels are financed by UK tax leases. In the event of any adverse tax changes or a successful challenge by the UK
Revenue authorities with regard to the initial tax basis of the transactions or in the event of an early termination of a lease, we
may be required to make additional payments to the UK vessel lessors, which could adversely affect our earnings and financial
position.
Two of our vessels are currently financed by UK tax leases. In the event of any adverse tax changes to legislation affecting the
tax treatment of the leases for the UK vessel lessors or a successful challenge by the UK Revenue authorities to the tax assumptions on
which the transactions were based, or in the event that we terminate one or more of our UK tax leases before their expiration, we would
be required to return all or a portion of, or in certain circumstances significantly more than, the upfront cash benefits that we have
received or that have accrued over time, together with fees that were financed in connection with our lease financing transactions, or
post additional security or make additional payments to the UK vessel lessors. Golar has agreed to indemnify us against these increased
costs (with respect to the 0HWKDQH3ULQFHVV lease but not with respect to the *RODU:LQWHU lease), but any default by Golar would not
limit our obligations under these leases. Any additional payments could adversely affect our earnings and financial position. For more
information on the UK tax leasesSOHDVHUHDG³,WHP²2SHUDWLQJDQG)LQDQFLDO5HYLHZDQG3URVSHFWV²/LTXLGLW\DQG&DSLWDO
5HVRXUFHV²%RUURZLQJ$FWLYLWLHV²&DSLWDO/HDVH2EOLJDWLRQV´
7KHHFRQRPLFGRZQWXUQPD\DIIHFWRXUFXVWRPHUV¶DELOLW\WRFKarter our vessels and pay for our services and may adversely
affect our business and results of operations.
The economic downturn in the global financial markets may lead to a decline in our cuVWRPHUV¶RSHUDWLRQVRU ability to pay for
our services, which could result in decreased demand for our vesselsDQGVHUYLFHV2XUFXVWRPHUV¶ inability to pay could also result in
their default on our current charters. The decline in the amount of services requested by our customers or their default on our charters
with them could have a material adverse effect on our business, financial condition and results of operations. We cannot determine
whether the difficult conditions in the economy and the financial markets will improve or worsen in the near future.
We currently operate primarily outside the United States, which could expose us to political, governmental and economic
instability that could harm our operations.
Because most of our operations are currently conducted outside of the United States, they may be affected by economic,
political and governmental conditions in the countries where we are engaged in business or where our vessels are registered. Any
disruption caused by these factors could harm our business. In particular, we derive a substantial portion of our revenues from shipping
LNG from politically unstable regions. Past political conflicts in these regions, particularly in the Arabian Gulf, Brazil and Indonesia,
have included attacks on ships, mining of waterways and other efforts to disrupt shipping in the area. In addition to acts of terrorism,
vessels trading in these and other regions have also been subject, in limited instances, to piracy. Future hostilities or other political
instability in the Arabian Gulf, Brazil and Indonesia where we operate or may operate could have a material adverse effect on the
growth of our business, results of operations and financial condition and our ability to make cash distributions. In addition, tariffs, trade
embargoes and other economic sanctions by Brazil, the United States or other countries against countries in the Middle East, Southeast
Asia or elsewhere as a result of terrorist attacks, hostilities or otherwise may limit trading activities with those countries, which could
also harm our business and ability to make cash distributions.
We may not be able to redeploy our FSRUs on terms as favorablHDVRXURU*RODU¶VFXUUHQW)658 charter arrangements or at
all.
The market for FSRUs is growing rapidly but is relatively small in comparison to the LNG carrier market. In the event that any
of the applicable charters are terminated, we may be unable to recharter the *RODU6SLULW, the *RODU:LQWHURUthe *RODU)UHH]H, as
FSRUs for an extended period of time. While we may be able to employ these vessels as traditional LNG carriers, the hire rates and/or
other charter terms may not be as favorable to us as our charters on the *RODU6SLULW and the *RODU:LQWHU with Petrobras and the charter
on the *RODU)UHH]H with Dubai Supply Authority (or DUSUP) if we acquire additional FSRUs, including the 1XVDQWDUD5HJDV6DWX
which is chartered to Nusantara Regas and they are not, as a result of contract termination or otherwise, subject to a long-term
profitable contract, we may be required to bid for projects at unattractive rates in order to reduce our losses relating to the vessels.
15
Due to our lack of diversification, adverse developments in our LNG transportation or storage and regasification businesses
could reduce our ability to make distributions to our unitholders.
We rely exclusively on the cash flow generated from our FSRUs and LNG carriers. Due to our lack of diversification, an
adverse development in the LNG transportation industry or the LNG storage and regasification industry could have a significantly
greater impact on our financial condition and results of operations than if we maintained more diverse assets or lines of businesses.
7KHVKDUHKROGHUV¶DJUHHPHQt with Chinese Petroleum Corporation with respect to the Golar Mazo contains provisions that may
limit our ability to sell or transfer our interest in the Golar Mazo, which could have a material adverse effect on our cash flows
and affect our ability to make distributions to our unitholders.
We have a 60% interest in the joint venture that owns the *RODU0D]R, which enables us to control the joint venture subject to
certain negative controls held by Chinese Petroleum Corporation (or CPC), who holds the remaining 40% interest in the *RODU0D]R.
8QGHUWKHVKDUHKROGHUV¶DJUHHPHQWQRSDUW\PD\VHOODVVLJQPRrtgage, or otherwise transfer its rights, interests or obligations under
the agreement without the prior written consent of the other party. If we determine that the sale or transfer of our interest in the *RODU
0D]R is in our best interest, we must provide CPC notice of our intent to sell or transfer our interest and grant CPC a right of first
refusal to purchase our interest. If CPC does not accept the offer within 60 days after we notify CPC, we will be free to sell or transfer
our interest to a third party. Any delay in the sale or transfer of our interest in the *RODU0D]R or restrictions in our ability to manage
the joint venture could have a material adverse effect on our cash flows and affect our ability to make distributions to our unitholders.
5LVNV5HODWHGWR2XU,QGXVWU\
The operation of FSRUs and LNG carriers is inherently risky, and an incident involving significant loss of life or
environmental consequences affecting any of our vessels could harm our reputation and business.
Our vessels and their cargoes are at risk of being damaged or lost because of events such as:
d marine disasters;
d piracy;
d environmental accidents;
d bad weather;
d mechanical failures;
d grounding, fire, explosions and collisions;
d human error; and
d war and terrorism.
An accident involving any of our vessels could result in any of the following:
d death or injury to persons, loss of property or environmental damage;
d delays in the delivery of cargo;
d loss of revenues from or termination of charter contracts;
d governmental fines, penalties or restrictions on conducting business;
d higher insurance rates; and
16
d damage to our reputation and customer relationships generally.
Any of these results could have a material adverse effect on our business, financial condition and operating results. If our
vessels suffer damage, they may need to be repaired. The costs of vessel repairs are unpredictable and can be substantial. We may
have to pay repair costs that our insurance policies do not cover. The loss of earnings while these vessels are being repaired, as well as
the actual cost of these repairs, would decrease our results of operations. If any of our vessels is involved in an accident with the
potential risk of environmental consequences, the resulting media coverage could have a material adverse effect on our business, our
results of operations and cash flows, weaken our financial condition and negatively affect our ability to make distributions to
unitholders.
A renewal of the global financial crisis could negatively impact our business.
Although there are signs that the economic recession has abated in some countries, there is still considerable instability in the
world economy and in the economies of countries such as Greece, Spain, Portugal and Italy that could initiate a new economic
downturn and result in a tightening in the credit markets, a low level of liquidity in financial markets, and volatility in credit and equity
markets. A renewal of the financial crisis that affected the banking system and the financial markets over the past three years may
negatively impact our business and financial condition in ways that we cannot predict. In addition, the uncertainty about current and
future global economic conditions caused by a renewed financial crisis may cause our customers and governments to defer projects in
response to tighter credit, decreased cash availability and declining customer confidence which may negatively impact the demand for
our services. A tightening of the credit markets may further negatively impact our operations by affecting the solvency of our suppliers
or customers which could lead to disruptions in delivery of supplies such as equipment for conversions, cost increases for supplies,
accelerated payments to suppliers, customer bad debts or reduced revenues.
Terrorist attacks, piracy, increased hostilities or war could lead to further economic instability, increased costs and disruption
of our business.
Terrorist attacks and the continuing response of the United States and others to these attacks, as well as the threat of future
terrorist attacks, continue to cause uncerWDLQW\LQWKHZRUOG¶VILQDQFLDOPDUNHWVDQd may affect our business, operating results, financial
condition, ability to raise capital and future growth. These uncertainties could also adversely affect our ability to obtain additional
financing on terms acceptable to us or at all. In the past, political conflicts have also resulted in attacks on vessels, mining of
waterways and other efforts to disrupt international shipping, particularly in the Arabian Gulf region. Acts of terrorism and piracy have
also affected vessels trading in regions such as the South China Sea and the Gulf of Aden off the coast of Somalia. Any of these
occurrences could have a material adverse impact on our business, financial condition, results of operations and ability to pay
distributions.
In addition, LNG facilities, shipyards, vessels (including FSRUs and conventional LNG carriers), pipelines and gas fields
could be targets of future terrorist attacks or piracy. Terrorist attacks, war or other events beyond our control that adversely affect the
production, storage, transportation or regasification of LNG to be shipped or processed by us could entitle our customers to terminate
our charters, which would harm our cash flow and our business. Concern that LNG facilities may be targeted for attack by terrorists
has contributed to significant community and environmental resistance to the construction of a number of LNG facilities, primarily in
North America. If a terrorist incident involving an LNG facility, FSRU or LNG carrier did occur, the incident may adversely affect
construction of additional LNG facilities or FSRUs or the temporary or permanent closing of various LNG facilities or FSRUs currently
in operation.
The LNG transportation, storage and regasification industry is subject to substantial environmental and other regulations,
compliance with which may significantly limit our operations or increase our expenses.
Our operations are materially affected by extensive and changing international, national and local environmental protection
laws, regulations, treaties, conventions and standards in force in international waters, the jurisdictional waters of the countries in which
RXUYHVVHOVRSHUDWHDVZHOODVWKHFRXQWULHVRIRXUYHVVHOV¶registration, including those relating to equipping and operating FSRUs and
LNG carriers, providing security and minimizing the potential for impacts to the environment from their operations. We have incurred,
and expect to continue to incur, substantial expenses in complying with these laws and regulations, including expenses for vessel
17
modifications and changes in operating procedures. Additional laws and regulations may be adopted that could limit our ability to do
business or further increase costs, which could harm our business. In addition, failure to comply with applicable laws and regulations
may result in administrative and civil penalties, criminal sanctions or the suspension or termination of operations. We may become
subject to additional laws and regulations if we enter new markets or trades.
These requirements can affect the resale value or useful lives of our vessels, require a reduction in cargo capacity, ship
modifications or operational changes or restrictions, lead to decreased availability of insurance coverage for environmental matters or
result in the denial of access to certain jurisdictional waters or ports, or detention in certain ports.
We may be unable to obtain, maintain, and/or renew permits necessary for our operations or experience delays in obtaining
such permits, which could have a material effect on our operations.
The design, construction and operation of FSRUs and interconnecting pipelines and the transportation of LNG are subject to
governmental approvals and permits. The permitting rules, and the interpretations of those rules, are complex, change frequently and
are often subject to discretionary interpretations by regulators, all of which may make compliance more difficult or impractical, and
may increase the length of time it takes to receive regulatory approval for offshore LNG operations. In the future, the relevant
regulatory authorities may take actions to prohibit the access of FSRUs or LNG carriers to various ports or adopt new rules and
regulations applicable to FSRUs and LNG carriers that will increase the time needed to obtain necessary environmental permits. We
cannot assure unitholders that such changes would not have a material effect on our operations.
Our vessels operating in international waters now or, in the future, will be subject to various federal, state and local laws and
regulations relating to protection of the environment.
Our vessels traveling in international waters are subject to various existing regulations published by the International Maritime
Organization (or the IMO) as well as marine pollution and prevention requirements imposed by the MARPOL Convention. In addition,
our LNG vessels may become subject to the International Convention on Liability and Compensation for Damage in Connection with
the Carriage of Hazardous and Noxious Substances by Sea, as amended by the April 2010 Protocol to the HNS Convention (or the 2010
HNS Convention), if it is entered into force. In addition, national laws generally provide for a LNG carrier or offshore LNG facility
owner or operator to bear strict liability for pollution, subject to a right to limit liability under applicable national or international
regimes for limitation of liability. However, some jurisdictions are not a party to an international regime limiting maritime pollution
OLDELOLW\DQGWKHUHIRUHDYHVVHORZQHU¶VRURSHUDWRU¶VULJKWVWROLPLWOLDELOLW\for maritime pollution in such jurisdictions may be
uncertain.
3OHDVHUHDG³,WHP,QIRUPDWLRQRQWKH3DUWQHUVKLS²%XVLQHVV2YHUYLHZ²(QYLURQPHQWDODQG2WKHU5HJXODWLRQV
International Maritime Regulations of LNG VeVVHOV´DQG³2WKHU5HJXODWLRQ´EHORZIRUDmore detailed discussion on these topics.
Our vessels operating in U.S. waters now or, in the future, will be subject to various federal, state and local laws and
regulations relating to protection of the environment.
Our vessels operating in U.S. waters now or, in the future, will be subject to various federal, state and local laws and
regulations relating to protection of the environment, including the Oil Pollution Act of 1990 (OPA 90), the U.S. Comprehensive
Environmental Response, Compensation, and Liability Act (CERLA), the Clean Water Act, and the Clean Air Act. In some cases,
these laws and regulations require us to obtain governmental permits and authorizations before we may conduct certain activities.
These environmental laws and regulations may impose substantial penalties for noncompliance and substantial liabilities for pollution.
Failure to comply with these laws and regulations may result in substantial civil and criminal fines and penalties. As with the industry
generally, our operations will entail risks in these areas, and compliance with these laws and regulations, which may be subject to
frequent revisions and reinterpretation, may increase our overall cost of business.
3OHDVHUHDG³,WHP,QIRUPDWLRQRQWKH3DUWQHUVKLS²%XVLQHVV2YHUYLHZ²(QYLURQPHQWDODQG2WKHU5HJXODWLRQV8QLWHG
6WDWHV(QYLURQPHQWDO5HJXODWLRQRI/1*9HVVHOV´EHORZIRUDPRUHdetailed discussion of the regulations applicable to our vessels.
18
)XUWKHUFKDQJHVWRH[LVWLQJHQYLURQPHQWDOOHJLVODWLRQWKDWLVDSSOLFDEOHWRLQWHUQDWLRQDODQGQDWLRQDOPDULWLPHWUDGHPD\KDYH
DQDGYHUVHHIIHFWRQRXUEXVLQHVV
We believe that the heightened environmental, quality and security concerns of insurance underwriters, regulators and
charterers will generally lead to additional regulatory requirements, including enhanced risk assessment and security requirements and
greater inspection and safety requirements on all LNG carriers in the marine transportation markets and offshore LNG terminals. These
requirements are likely to add incremental costs to our operations and the failure to comply with these requirements may affect the
ability of our vessels to obtain and, possibly, collect on insurance or to obtain the required certificates for entry into the different ports
where we operate.
Further legislation, or amendments to existing legislation, applicable to international and national maritime trade are expected
over the coming years in areas such as ship recycling, sewage systems, emission control (including emissions of greenhouse gases),
ballast treatment and handling, etc. The United States has recently enacted legislation and regulations that require more stringent
controls of air and water emissions from ocean-going vessels. Such legislation or regulations may require additional capital
expenditures or operating expenses (such as increased costs for low-sulfur fuel) in order for us to maintainRXUYHVVHOV¶FRPSOiance with
international and/or national regulations.
&OLPDWHFKDQJHDQGJUHHQKRXVHJDVUHVWULFWLRQVPD\DGYHUVHO\LPSDFWRXURSHUDWLRQVDQGPDUNHWV
Due to concern over the risk of climate change, a number of countries and the IMO have adopted, or are considering the
adoption of, regulatory frameworks to reduce greenhouse gas emission from vessel emissions. These regulatory measures may include,
among others, adoption of cap and trade regimes, carbon taxes, increased efficiency standards, and incentives or mandates for
renewable energy. Also, a treaty may be adopted in the future that includes restrictions on shipping emissions. Compliance with
changes in laws and regulations relating to climate change could increase our costs of operating and maintaining our vessels and could
require us to make significant financial expenditures that we cannot predict with certainty at this time.
Adverse effects upon the oil and gas industry relating to climate change, including growing public concern about the
environmental impact of climate change, may also have an affect on demand for our services. For example, increased regulation of
greenhouse gases or other concerns relating to climate change may reduce the demand for oil and gas in the future or create greater
incentives for use of alternative energy sources. Any long-term material adverse effect on the oil and gas industry could have a
significant financial and operational adverse impact on our business that we cannot predict with certainty at this time.
3OHDVHUHDG³,WHP,QIRUPDWLRQRQWKH3DUWQHUVKLS²%XVLQHVV2YHUYLHZ²(QYLURQPHQWDODQG2WKHU5HJXODWLRQV²5HJXODWLRQ
RI*UHHQKRXVH*DV(PLVVLRQV´EHORZIRUDPRUHGHWDLOHGGLVFXVVLRQ
0DULWLPHFODLPDQWVFRXOGDUUHVWRXUYHVVHOVZKLFKFRXOGLQWHUUXSWRXUFDVKIORZ
If we are in default on some kinds of obligations, such as those to our lenders, crew members, suppliers of goods and services
to our vessels or shippers of cargo, these parties may be entitled to a maritime lien against one or more of our vessels. In many
jurisdictions, a maritime lien holder may enforce its lien by arresting a vessel through foreclosure proceedings. In a few jurisdictions,
FODLPDQWVFRXOGWU\WRDVVHUW³VLVWHUVKLS´OLDELOLW\DJDLQVWRQHYHVVHOLQRXUIOHHWIRUFODLPVUHODWLQJWRDQRWKHURIRXUYHVsels. The arrest
or attachment of one or more of our vessels could interrupt our cash flow and require us to pay to have the arrest lifted. Under some of
our present charters, if the vessel is arrested or detained (for as few as 14 days in the case of one of our charters) as a result of a claim
against us, we may be in default of our charter and the charterer may terminate the charter. This would negatively impact our revenues
and reduce our cash available for distribution to unitholders.
&RPSOLDQFHZLWKVDIHW\DQGRWKHUYHVVHOUHTXLUHPHQWVLPSRVHGE\FODVVLILFDWLRQVRFLHWLHVPD\EHYHU\FRVWO\DQGPD\DGYHUVHO\
DIIHFWRXUEXVLQHVV
The hull and machinery of every large, oceangoing commercial vessel must be classed by a classification society authorized by
its country of registry. The classification society certifies that a vessel is safe and seaworthy in accordance with the applicable rules and
regulations of the country of registry of the vessel and the Safety of Life
19
at Sea Convention. The *RODU0D]R is certified by Lloyds Register, and the 0HWKDQH3ULQFHVV, the *RODU6SLULW, the *RODU:LQWHU and
the *RODU)UHH]H are each certified by Det Norske Veritas.
As part of the certification process, a vessel must undergo annual surveys, intermediate surveys and special surveys. In lieu of
DVSHFLDOVXUYH\DYHVVHO¶VPDFKLQHU\PD\EHRQDFRQWLQXRXVVXrvey cycle, under which the machinery would be surveyed periodically
over a five-year period. Each of the vessels in our existing fleet is on a planned maintenance system approval, and as such the
classification society attends onboard once every year to verify that the maintenance of the equipment onboard is done correctly. Each
of the vessels in our existing fleet is required to be qualified within its respective classification society for drydocking once every five
years subject to an intermediate underwater survey done using an approved diving company in the presence of a surveyor from the
classification society.
If any vessel does not maintain its class or fails any annual survey, intermediate survey or special survey, the vessel will be
unable to trade between ports and will be unemployable. We would lose revenue while the vessel was off-hire and incur costs of
compliance. This would negatively impact our revenues and reduce our cash available for distribution to unitholders.
5LVNV,QKHUHQWLQDQ,QYHVWPHQWLQ8V
*RODUDQGLWVDIILOLDWHVPD\FRPSHWHZLWKXV
Pursuant to the omnibus agreement, Golar and its controlled affiliates (other than us, our general partner and our subsidiaries)
generally agreed not to acquire, own, operate or charter certain FSRUs and LNG carriers operating under charters of five years or
more. The omnibus agreement, however, contains significant exceptions that may allow Golar and its controlled affiliates to compete
ZLWKXVZKLFKFRXOGKDUPRXUEXVLQHVV3OHDVHUHDG³,WHP²Major Unitholders and Related PaUW\7UDQVDFWLRQV²5HODWHG3DUW\
7UDQVDFWLRQV²2PQLEXV$JUHHPHQW²1RQFRPSHWLWLRQ´
8QLWKROGHUVKDYHOLPLWHGYRWLQJULJKWVDQGRXUSDUWQHUVKLSDJUHHPHQWUHVWULFWVWKHYRWLQJULJKWVRIWKHXQLWKROGHUVRZQLQJ
PRUHWKDQRIRXUFRPPRQXQLWV
Unlike the holders of common stock in a corporation, holders of common units have only limited voting rights on matters
affecting our business. We will hold a meeting of the limited partners every year to elect one or more members of our board of
directors and to vote on any other matters that are properly brought before the meeting. Common unitholders will be entitled to elect
only four of the seven members of our board of directors. The elected directors will be elected on a staggered basis and will serve for
three year terms. Our general partner in its sole discretion will appoint the remaining three directors and set the terms for which those
directors will serve. The partnership agreement also contains provisions limiting the ability of unitholders to call meetings or to acquire
information about our operations, as well as other provisions limiting the unitholderV¶DELOLW\WRLQIOXHQFHWKHPDQQHURUGLUHction of
management. Unitholders will have no right to elect our general partner, and our general partner may not be removed except by a vote
of the holders of at least 66/% of the outstanding common units and subordinated units, including any common units or subordinated
units owned by our general partner and its affiliates, voting together as a single class.
2
3
Our partnership agreement further restrictVXQLWKROGHUV¶YRWLQJULJKWVE\SURYLGLQJWKDWLIDQ\SHUVRQRUJURXSRZQV
beneficially more than 4.9% of any class of units then outstanding, any such units owned by that person or group in excess of 4.9% may
not be voted on any matter and will not be considered to be outstanding when sending notices of a meeting of unitholders, calculating
required votes (except for purposes of nominating a person for election to our board), determining the presence of a quorum or for other
similar purposes, unless required by law. The voting rights of any such unitholders in excess of 4.9% will effectively be redistributed
pro rata among the other common unitholders holding less than 4.9% of the voting power of all classes of units entitled to vote. Our
general partner, its affiliates and persons who acquired common units with the prior approval of our board of directors will not be
subject to this 4.9% limitation except with respect to voting their common units in the election of the elected directors.
20
2XUJHQHUDOSDUWQHUDQGLWVRWKHUDIILOLDWHVRZQDVLJQLILFDQWLQWHUHVWLQXVDQGKDYHFRQIOLFWVRILQWHUHVWDQGOLPLWHGILGXFLDU\
DQGFRQWUDFWXDOGXWLHVZKLFKPD\SHUPLWWKHPWRIDYRUWKHLURZQLQWHUHVWVWRWKHGHWULPHQWRIRXUXQLWKROGHUV
Golar owns a 63.4% limited partner interest in us and owns and controls our general partner. All of our officers and certain of
our directors are directors and/or officers of Golar or its affiliates and, as such, they have fiduciary duties to Golar that may cause them
to pursue business strategies that disproportionately benefit Golar or which otherwise are not in the best interests of us or our
unitholders. Conflicts of interest may arise between Golar and its affiliates (including our general partner) on the one hand, and us and
our unitholders, on the other hand. As a result of these conflicts, our general partner and its affiliates may favor their own interests over
the interests of our unitholders. These conflicts include, among others, the following situations:
d neither our partnership agreement nor any other agreement requires our general partner or Golar or its affiliates to pursue
a business strategy that favors us or utilizes our assets, and *RODU¶VRIILFHUVDQGGLUHFWRUVKDve a fiduciary duty to make
decisions in the best interests of the shareholders of Golar, which may be contrary to our interests;
d our partnership agreement permits our general partner to make a number of decisions in its individual capacity, as
opposed to in its capacity as our general partner. Specifically, our general partner will be considered to be acting in its
individual capacity if it exercises its call right, pre-emptive rights, registration rights or right to make a determination to
receive common units in exchange for resetting the target distribution levels related to the incentive distribution rights,
consents or withholds consent to any merger or consolidation of the partnership, appoints any directors or votes for the
election of any director, votes or refrains from voting on amendments to our partnership agreement that require a vote of
the outstanding units, voluntarily withdraws from the partnership, transfers (to the extent permitted under our partnership
agreement) or refrains from transferring its units, general partner interest or incentive distribution rights or votes upon the
dissolution of the partnership;
d our general partner and our directors have limited their liabilities and reduced their fiduciary duties under the laws of the
Marshall Islands, while also restricting the remedies available to our unitholders, and, as a result of purchasing common
units, unitholders are treated as having agreed to the modified standard of fiduciary duties and to certain actions that may
be taken by our general partner and our directors, all as set forth in the partnership agreement;
d our general partner is entitled to reimbursement of all reasonable costs incurred by it and its affiliates for our benefit;
d our partnership agreement does not restrict us from paying our general partner or its affiliates for any services rendered to
us on terms that are fair and reasonable or entering into additional contractual arrangements with any of these entities on
our behalf;
d our general partner may exercise its right to call and purchase our common units if it and its affiliates own more than 80%
of our common units; and
d our general partner is not obligated to obtain a fairness opinion regarding the value of the common units to be repurchased
by it upon the exercise of its limited call right.
Although a majority of our directors will over time be elected by common unitholders, our general partner will likely have
substantial influence on decisions made by our board of directors.
2XURIILFHUVIDFHFRQIOLFWVLQWKHDOORFDWLRQRIWKHLUWLPHWRRXUEXVLQHVV
Our officers, all but one of whom are directors or officers of Golar Management and perform executive officer functions for us
pursuant to the management and administrative services agreement, are not required to work full-time on our affairs and also perform
services for affiliates of our general partner, including Golar. The affiliates of our general partner, including Golar, conduct substantial
businesses and activities of their own in which we have
21
no economic interest. As a result, there could be material competition for the time and effort of our officers who also provide services
WRRXUJHQHUDOSDUWQHU¶VDIILOLDWHs, which could have a material adverse effect on our business, results of operations and financial
FRQGLWLRQ3OHDVHUHDG³,WHP²'LUHFWRUV6HQLRU0DQDJHPHQWDQG(PSOR\HHV´
2XUSDUWQHUVKLSDJUHHPHQWOLPLWVRXUJHQHUDOSDUWQHU¶VDQGRXUGLUHFWRUV¶ILGXFLDU\GXWLHVWRRXUXQLWKROGHUVDQGUHVWULFWVWKH
UHPHGLHVDYDLODEOHWRXQLWKROGHUVIRUDFWLRQVWDNHQE\RXUJHQHUDOSDUWQHURURXUGLUHFWRUV
Our partnership agreement provides that our general partner will delegate to our board of directors the authority to oversee and
direct our operations, management and policies on an exclusive basis, and such delegation will be binding on any successor general
partner of the partnership. Our partnership agreement also contains provisions that reduce the standards to which our general partner
and directors would otherwise be held by Marshall Islands law. For example, our partnership agreement:
d permits our general partner to make a number of decisions in its individual capacity, as opposed to in its capacity as our
general partner. Where our partnership agreement permits, our general partner may consider only the interests and factors
that it desires, and in such cases it has no fiduciary duty or obligation to give any consideration to any interest of, or
factors affecting, us, our affiliates or our unitholders. Decisions made by our general partner in its individual capacity will
be made by its sole owner, Golar. Specifically, pursuant to our partnership agreement, our general partner will be
considered to be acting in its individual capacity if it exercises its right to make a determination to receive common units
in exchange for resetting the target distribution levels related to the incentive distribution rights, call right, pre-emptive
rights or registration rights, consents or withholds consent to any merger or consolidation of the partnership, appoints any
directors or votes for the election of any director, votes or refrains from voting on amendments to our partnership
agreement that require a vote of the outstanding units, voluntarily withdraws from the partnership, transfers (to the extent
permitted under our partnership agreement) or refrains from transferring its units, general partner interest or incentive
distribution rights or votes upon the dissolution of the partnership;
d provides that our general partner and our directors are entitled to makeRWKHUGHFLVLRQVLQ³JRRGIDLWK´LIWKH\UHDVRQDEO\
believe that the decision is in our best interests;
d generally provides that affiliated transactions and resolutions of conflicts of interest not approved by the conflicts
committee of our board of directors and not involving a vote of unitholders must be on terms no less favorable to us than
those generally being provided to or available from unrelated thLUGSDUWLHVRUEH³IDLUDQGUHDVRQDEOH´WRXV and that, in
determining whether a transaction or resoluWLRQLV³IDLUDQGUHDVRQDEOH´RXUERDUGof directors may consider the totality of
the relationships between the parties involved, including other transactions that may be particularly advantageous or
beneficial to us; and
d provides that neither our general partner nor our officers or our directors will be liable for monetary damages to us, our
limited partners or assignees for any acts or omissions unless there has been a final and non-appealable judgment entered
by a court of competent jurisdiction determining that our general partner or directors or its officers or directors or those
other persons engaged in actual fraud or willful misconduct.
In order to become a limited partner of our partnership, a common unitholder is required to agree to be bound by the
provisions in the partnership agreement, including the provisions discussed above.
)HHVDQGFRVWUHLPEXUVHPHQWVZKLFK*RODU0DQDJHPHQWGHWHUPLQHVIRUVHUYLFHVSURYLGHGWRXVDUHVXEVWDQWLDODUHSD\DEOH
UHJDUGOHVVRIRXUSURILWDELOLW\DQGUHGXFHRXUFDVKDYDLODEOHIRUGLVWULEXWLRQWRRXUXQLWKROGHUV
Pursuant to the fleet management agreements, we pay fees for services provided to us and our subsidiaries by Golar
Management (a subsidiary of Golar) and certain other affiliates of Golar, including Golar Wilhelmsen, and we reimburse these entities
for all expenses they incur on our behalf. These fees and expenses include all costs and expenses incurred in providing certain
commercial and technical management services to our subsidiaries.
22
In addition, pursuant to a management and administrative services agreement Golar Management provides us with significant
management, administrative, financial and other support services. We reimburse Golar Management for its reasonable costs and
expenses incurred in connection with the provision of these services. In addition, we pay Golar Management a management fee equal
to 5% of its costs and expenses incurred in connection with providing services to us.
For a description of the fleet management agreements and the management and administrative services agreement, please read
³,WHP²0DMRU8QLWKROGHUVDQG5HODWHG3DUW\7UDQVDFWLRQV´)HHVDQGH[SHQVHVSD\DEOHpursuant to the fleet management agreements
and the management and administrative services agreement are payable without regard to our financial condition or results of
operations. The payment of fees to and the reimbursement of expenses of Golar Management, Golar Wilhelmsen and certain other
affiliates of Golar could adversely affect our ability to pay cash distributions to our unitholders.
2XUSDUWQHUVKLSDJUHHPHQWFRQWDLQVSURYLVLRQVWKDWPD\KDYHWKHHIIHFWRIGLVFRXUDJLQJDSHUVRQRUJURXSIURPDWWHPSWLQJWR
UHPRYHRXUFXUUHQWPDQDJHPHQWRURXUJHQHUDOSDUWQHUDQGHYHQLISXEOLFXQLWKROGHUVDUHGLVVDWLVILHGWKH\ZLOOEHXQDEOHWR
UHPRYHRXUJHQHUDOSDUWQHUZLWKRXW*RODU¶VFRQVHQWXQOHVV*RODU¶VRZQHUVKLSLQWHUHVWLQXVLVGHFUHDVHGDOORIZKLFKFRXOG
GLPLQLVKWKHWUDGLQJSULFHRIRXUFRPPRQXQLWV
Our partnership agreement contains provisions that may have the effect of discouraging a person or group from attempting to
remove our current management or our general partner.
d The unitholders will be unable initially to remove our general partner without its consent because our general partner and
its affiliates own sufficient units to be able to prevent its removal. The vote of the holders of at least 66/% of all
outstanding common and subordinated units voting together as a single class is required to remove the general partner.
Golar currently owns 64.7% of the outstanding common and subordinated units.
2
3
d If our general partner is removed withouW³FDXVH´GXULQJWKHVXERUGLQDWLRQSHULRGand units held by our general partner
and Golar are not voted in favor of that removal, all remaining subordinated units will automatically convert into common
units, any existing arrearages on the common units will be extinguished, and our general partner will have the right to
convert its general partner interest and its incentive distribution rights (and Golar will have the right to convert its
incentive distribution rights) into common units or to receive cash in exchange for those interests based on the fair market
value of those interests at the time. A removal of our general partner under these circumstances would adversely affect
the common units by prematurely eliminating their distribution and liquidation preference over the subordinated units,
which would otherwise have continued until we had met certain distribution and performance tests. Any conversion of
the general partner interest or incentive distribution rights would be dilutive to existing unitholders. Furthermore, any
cash payment in lieu of such conversion FRXOGEHSURKLELWLYHO\H[SHQVLYH³&DXVH´LVQDUURZO\GHILQHGWRPHDQWKDWD
court of competent jurisdiction has entered a final, non-appealable judgment finding our general partner liable for actual
fraud or willful or wanton misconduct in its capacity as our general partner. Cause does not include most cases of charges
of poor business decisions, such as charges of poor management of our business by the directors appointed by our general
partner, so the removal of our general partner because ofWKHXQLWKROGHUV¶GLVVDWLVIDFWLRQZLWKWKHJHQHUDOSDUWQHU¶V
decisions in this regard would most likely result in the termination of the subordination period.
d Common unitholders will be entitled to elect only four of the seven members of our board of directors. Our general
partner in its sole discretion will appoint the remaining three directors.
d Election of the four directors elected by unitholders is staggered, meaning that the members of only one of three classes of
our elected directors will be selected each year. In addition, the directors appointed by our general partner will serve for
terms determined by our general partner.
d Our partnership agreement contains provisions limiting the ability of unitholders to call meetings of unitholders, to
nominate directors and to acquire information about our operations as well as other provisions limLWLQJWKHXQLWKROGHUV¶
ability to influence the manner or direction of management.
23
d 8QLWKROGHUV¶YRWLQJULJKWVDUHIXUWKHUUHVWricted by the partnership agreement provision providing that if any person or
group owns beneficially more than 4.9% of any class of units then outstanding, any such units owned by that person or
group in excess of 4.9% may not be voted on any matter and will not be considered to be outstanding when sending
notices of a meeting of unitholders, calculating required votes (except for purposes of nominating a person for election to
our board), determining the presence of a quorum or for other similar purposes, unless required by law. The voting rights
of any such unitholders in excess of 4.9% will effectively be redistributed pro rata among the other common unitholders
holding less than 4.9% of the voting power of all classes of units entitled to vote. Our general partner, its affiliates and
persons who acquired common units with the prior approval of our board of directors will not be subject to this 4.9%
limitation except with respect to voting their common units in the election of the elected directors.
d There are no restrictions in our partnership agreement on our ability to issue equity securities.
The effect of these provisions may be to diminish the price at which the common units will trade.
7KHFRQWURORIRXUJHQHUDOSDUWQHUPD\EHWUDQVIHUUHGWRDWKLUGSDUW\ZLWKRXWXQLWKROGHUFRQVHQW
Our general partner may transfer its general partner interest to a third party in a merger or in a sale of all or substantially all of
its assets without the consent of the unitholders. In addition, our partnership agreement does not restrict the ability of the members of
our general partner from transferring their respective membership interests in our general partner to a third party.
6XEVWDQWLDOIXWXUHVDOHVRIRXUFRPPRQXQLWVLQWKHSXEOLFPDUNHWFRXOGFDXVHWKHSULFHRIRXUFRPPRQXQLWVWRIDOO
We have granted registration rights to Golar and certain of its affiliates. These unitholders have the right, subject to some
conditions, to require us to file registration statements covering any of our common, subordinated or other equity securities owned by
them or to include those securities in registration statements that we may file for ourselves or other unitholders. Golar owns 9,327,254
common units and 15,949,831 subordinated units and 100% of the incentive distribution rights (directly and through its ownership of
our general partner). Following their registration and sale under the applicable registration statement, those securities will become
freely tradable. By exercising their registration rights and selling a large number of common units or other securities, these unitholders
could cause the price of our common units to decline.
2XUJHQHUDOSDUWQHUDVWKHKROGHURIDPDMRULW\RIWKHLQFHQWLYHGLVWULEXWLRQULJKWVPD\HOHFWWRFDXVHXVWRLVVXHDGGLWLRQDO
FRPPRQXQLWVWRLWDQG*RODULQFRQQHFWLRQZLWKDUHVHWWLQJRIWKHWDUJHWGLVWULEXWLRQOHYHOVUHODWHGWRRXUJHQHUDOSDUWQHU¶VDQG
*RODU¶VLQFHQWLYHGLVWULEXWLRQULJKWVZLWKRXWWKHDSSURYDORIWKHFRQIOLFWVFRPPLWWHHRIRXUERDUGRIGLUHFWRUVRUKROGHUVRIRXU
FRPPRQXQLWVDQGVXERUGLQDWHGXQLWV7KLVPD\UHVXOWLQORZHUGLVWULEXWLRQVWRKROGHUVRIRXUFRPPRQXQLWVLQFHUWDLQ
VLWXDWLRQV
Our general partner, as the initial holder of a majority of the incentive distribution rights, has the right, at a time when there are
no subordinated units outstanding and our general partner and Golar have received incentive distributions at the highest level to which
they are entitled (48%) for each of the prior four consecutive fiscal quarters, to reset the initial cash target distribution levels at higher
levels based on the distribution at the time of the exercise of the reset election. Following a reset election by our general partner, the
minimum quarterly distribution amount will be reset to an amount equal to the average cash distribution amount per common unit for
the two fiscal quarters immediately preceding the reset election (such amount is refeUUHGWRDVWKH³UHVHWPLQLPXPTXDUWHUO\
GLVWULEXWLRQ´DQGWKHWDUJHWGLVWULEXWLRQOHvels will be reset to correspondingly higher levels based on the same percentage increases
above the reset minimum quarterly distribution amount.
In connection with resetting these target distribution levels, our general partner and Golar will be entitled to receive a number
of common units equal to that number of common units whose aggregate quarterly cash distributions equaled the average of the
distributions to our general partner and Golar on the incentive distribution rights in the prior two quarters. We anticipate that our
general partner would exercise this reset right in order to facilitate acquisitions or internal growth projects that would not be sufficiently
accretive to cash distributions per common unit without such conversion; however, it is possible that our general partner could exercise
this reset
24
election at a time when it is experiencing, or may be expected to experience, declines in the cash distributions it receives related to its
incentive distribution rights and may therefore desire to be issued our common units, rather than retain the right to receive incentive
distributions based on the initial target distribution levels. As a result, a reset election may cause our common unitholders to experience
dilution in the amount of cash distributions that they would have otherwise received had we not issued additional common units to our
general partner in connection with resetting the target distribution levels related to our geneUDOSDUWQHU¶VDQG*RODU¶VLQFHQWive
distribution rights.
:HPD\LVVXHDGGLWLRQDOHTXLW\VHFXULWLHVLQFOXGLQJVHFXULWLHVVHQLRUWRWKHFRPPRQXQLWVZLWKRXWWKHDSSURYDORIRXU
XQLWKROGHUVZKLFKZRXOGGLOXWHRXUFXUUHQWXQLWKROGHUV¶RZQHUVKLSLQWHUHVWV
We may, without the approval of our unitholders, issue an unlimited number of additional units or other equity securities. In
addition, we may issue an unlimited number of units that are senior to the common units in right of distribution, liquidation and voting.
The issuance by us of additional common units or other equity securities of equal or senior rank will have the following effects:
d RXUXQLWKROGHUV¶SURSRUWLRQDWHRZQHrship interest in us will decrease;
d the amount of cash available for distribution on each unit may decrease;
d because a lower percentage of total outstanding units will be subordinated units, the risk that a shortfall in the payment of
the minimum quarterly distribution will be borne by our common unitholders will increase;
d the relative voting strength of each previously outstanding unit may be diminished; and
d the market price of the common units may decline.
8SRQWKHH[SLUDWLRQRIWKHVXERUGLQDWLRQSHULRGWKHVXERUGLQDWHGXQLWVZLOOFRQYHUWLQWRFRPPRQXQLWVDQGZLOOWKHQ
SDUWLFLSDWHSURUDWDZLWKRWKHUFRPPRQXQLWVLQGLVWULEXWLRQVRIDYDLODEOHFDVK
During the subordination period, which we define elsewhere in this Annual Report, the common units will have the right to
receive distributions of available cash from operating surplus in an amount equal to the minimum quarterly distribution of $0.3850per
unit, plus any arrearages in the payment of the minimum quarterly distribution on the common units from prior quarters, before any
distributions of available cash from operating surplus may be made on the subordinated units. Distribution arrearages do not accrue on
the subordinated units. The purpose of the subordinated units is to increase the likelihood that during the subordination period there
will be available cash from operating surplus to be distributed on the common units. Upon the expiration of the subordination period,
the subordinated units will convert into common units and will then participate pro rata with other common units in distributions of
DYDLODEOHFDVK6HH³,WHP²)LQDQFLDO,QIRUPDWLRQ²2XU&DVK'LVWULEXWLRQ3ROLF\´
,QHVWDEOLVKLQJFDVKUHVHUYHVRXUERDUGRIGLUHFWRUVPD\UHGXFHWKHDPRXQWRIFDVKDYDLODEOHIRUGLVWULEXWLRQWRRXU
XQLWKROGHUV
Our partnership agreement requires our general partner to deduct from operating surplus cash reserves that it determines are
necessary to fund our future operating expenditures. These reserves also will affect the amount of cash available for distribution to our
unitholders. Our board of directors may establish reserves for distributions on the subordinated units, but only if those reserves will not
prevent us from distributing the full minimum quarterly distribution, plus any arrearages, on the common units for the following four
TXDUWHUV$VGHVFULEHGDERYHLQ³²5LVNV,QKHUHQWLQ2XU%XVLQHVV²:HPXVWPDNHVXEVWDQWLDOFDSLWal expenditures to maintain and
replace the operating capacity of our fleet, which will reduce our cash available for distribution. In addition, each quarter we are
required to deduct estimated maintenance and replacement capital expenditures from operating surplus, which may result in less cash
available to unitholders than if actual maintenance and replacement capital expenditures were deductHG´RXUSDUWQHUVKLSDJUHHPent
requires our board of directors each quarter to deduct from operating surplus estimated maintenance and replacement capital
expenditures, as opposed to actual maintenance and replacement capital expenditures, which could reduce the amount of available cash
for distribution. The amount of estimated maintenance and replacement capital expenditures deducted from operating surplus is subject
to review and change
25
by our board of directors at least once a year, provided that any change must be approved by the conflicts committee of our board of
directors.
2XUJHQHUDOSDUWQHUKDVDOLPLWHGFDOOULJKWWKDWPD\UHTXLUHXQLWKROGHUVWRVHOOWKHLUFRPPRQXQLWVDWDQXQGHVLUDEOHWLPHRU
SULFH
If at any time our general partner and its affiliates own more than 80% of the common units, our general partner will have the
right, which it may assign to any of its affiliates or to us, but not the obligation, to acquire all, but not less than all, of the common units
held by unaffiliated persons at a price not less than the then-current market price of our common units. Our general partner is not
obligated to obtain a fairness opinion regarding the value of the common units to be repurchased by it upon the exercise of this limited
call right. As a result, unitholders may be required to sell their common units at an undesirable time or price and may not receive any
return on their investment. Unitholders may also incur a tax liability upon a sale of units.
Golar, which owns and controls our general partner, currently owns 40.3% of our common units. At the end of the
subordination period, assuming we do not issue any additional common units and the conversion of our subordinated units into
common units, Golar will own 64.7% of our common units.
8QLWKROGHUVPD\QRWKDYHOLPLWHGOLDELOLW\LIDFRXUWILQGVWKDWXQLWKROGHUDFWLRQFRQVWLWXWHVFRQWURORIRXUEXVLQHVV
As a limited partner in a partnership organized under the laws of the Marshall Islands, a unitholder could be held liable for our
obligations to the same extent as a general partner if a unitholder participates in thH³FRQWURO´RIRXUEXVLQHVV2XUJHQHUDO partner
generally has unlimited liability for the obligations of the partnership, such as its debts and environmental liabilities, except for those
contractual obligations of the partnership that are expressly made without recourse to our general partner. In addition, the limitations
on the liability of holders of limited partner interests for the obligations of a limited partnership have not been clearly established in
some jurisdictions in which we do business.
:HFDQERUURZPRQH\WRSD\GLVWULEXWLRQVZKLFKZRXOGUHGXFHWKHDPRXQWRIFUHGLWDYDLODEOHWRRSHUDWHRXUEXVLQHVV
Our partnership agreement allows us to make working capital borrowings to pay distributions. Accordingly, if we have
available borrowing capacity, we can make distributions on all our units even though cash generated by our operations may not be
sufficient to pay such distributions. Any working capital borrowings by us to make distributions will reduce the amount of working
capital borrowings we can make for operating our business. For moUHLQIRUPDWLRQSOHDVHUHDG³,WHP²2SHUDWLQJDQG)LQDQFLDO
5HYLHZDQG3URVSHFWV²/LTXLGLW\DQG&DSLWDO5HVRXUFHV´
,QFUHDVHVLQLQWHUHVWUDWHVPD\FDXVHWKHPDUNHWSULFHRIRXUFRPPRQXQLWVWRGHFOLQH
An increase in interest rates may cause a corresponding decline in demand for equity investments in general, and in particular
for yield-based equity investments such as our common units. Any such increase in interest rates or reduction in demand for our
common units resulting from other relatively more attractive investment opportunities may cause the trading price of our common units
to decline.
8QLWKROGHUVPD\KDYHOLDELOLW\WRUHSD\GLVWULEXWLRQV
Under some circumstances, unitholders may have to repay amounts wrongfully returned or distributed to them. Under the
Marshall Islands Limited Partnership Act (or the Marshall Islands Act), we may not make a distribution to unitholders if the distribution
would cause our liabilities to exceed the fair value of our assets. Marshall Islands law provides that for a period of three years from the
date of the impermissible distribution, limited partners who received the distribution and who knew at the time of the distribution that it
violated Marshall Islands law will be liable to the limited partnership for the distribution amount. Assignees who become substituted
limited partners are liable for the obligations of the assignor to make contributions to the partnership that are known to the assignee at
the time it became a limited partner and for unknown obligations if the liabilities could be determined
26
from the partnership agreement. Liabilities to partners on account of their partnership interest and liabilities that are non-recourse to the
partnership are not counted for purposes of determining whether a distribution is permitted.
:HKDYHEHHQRUJDQL]HGDVDOLPLWHGSDUWQHUVKLSXQGHUWKHODZVRIWKH5HSXEOLFRIWKH0DUVKDOO,VODQGVZKLFKGRHVQRWKDYHD
ZHOOGHYHORSHGERG\RISDUWQHUVKLSODZ
Our partnership affairs are governed by our partnership agreement and by the Marshall Islands Act. The provisions of the
Marshall Islands Act resemble provisions of the limited partnership laws of a number of states in the United States, most notably
Delaware. The Marshall Islands Act also provides that it is to be applied and construed to make it uniform with the Delaware Revised
Uniform Partnership Act and, so long as it does not conflict with the Marshall Islands Act or decisions of the Marshall Islands courts,
interpreted according to the non-statutory law (or case law) of the State of Delaware. There have been, however, few, if any, court
cases in the Marshall Islands interpreting the Marshall Islands Act, in contrast to Delaware, which has a fairly well-developed body of
case law interpreting its limited partnership statute. Accordingly, we cannot predict whether Marshall Islands courts would reach the
same conclusions as the courts in Delaware. For example, the rights of our unitholders and the fiduciary responsibilities of our general
partner under Marshall Islands law are not as clearly established as under judicial precedent in existence in Delaware. As a result,
unitholders may have more difficulty in protecting their interests in the face of actions by our general partner and its officers and
directors than would unitholders of a similarly organized limited partnership in the United States.
%HFDXVHZHDUHRUJDQL]HGXQGHUWKHODZVRIWKH0DUVKDOO,VODQGVLWPD\EHGLIILFXOWWRVHUYHXVZLWKOHJDOSURFHVVRUHQIRUFH
MXGJPHQWVDJDLQVWXVRXUGLUHFWRUVRURXUPDQDJHPHQW
We are organized under the laws of the Marshall Islands, and substantially all of our assets are located outside of the United
States. In addition, our general partner is a Marshall Islands limited liability company, and our directors and officers generally are or
will be non-residents of the United States, and all or a substantial portion of the assets of these non-residents are located outside the
United States. As a result, it may be difficult or impossible for a unitholder to bring an action against us or against these individuals in
the United States if such unitholder believes that its rights have been infringed under securities laws or otherwise. Even if a unitholder
is successful in bringing an action of this kind, the laws of the Marshall Islands and of other jurisdictions may prevent or restrict such
unitholder from enforcing a judgment against our assets or the assets of our general partner or our directors or officers.
7D[5LVNV
In addition to the followiQJULVNIDFWRUVUHDG³,WHP²,QIRUPDWLRQRQWKH3DUWQHUVKLS²7D[DWLRQRIWKH3DUWQHUVKLS´³,WHP
²$GGLWLRQDO,QIRUPDWLRQ²7D[DWLRQ²0DWHrial U.S. Federal Income Tax ConsidHUDWLRQV´DQG³²1RQ8QLWHG6WDWHV7D[
&RQVLGHUDWLRQV´IRUDPRUHFRPSOHWH discussion of the expected material U.S. federal and non-U.S. income tax considerations relating
to us and the ownership and disposition of our common units. RHDG³,WHP².H\,QIRUPDWLRQ²5LVN)DFWRUV²5LVNV,QKHUHQWLQ2XU
%XVLQHVV´IRUDGLVFXVVLRQRQrisks relating to UK tax leases.
86WD[DXWKRULWLHVFRXOGWUHDWXVDVD³SDVVLYHIRUHLJQLQYHVWPHQWFRPSDQ\´ZKLFKZRXOGKDYHDGYHUVH86IHGHUDOLQFRPH
WD[FRQVHTXHQFHVWR86XQLWKROGHUV
A non-U.S. entity treated as a corporation for U.S. IHGHUDOLQFRPHWD[SXUSRVHVZLOOEHWUHDWHGDVD³passive foreign investment
FRPSDQ\´RU3),&IRU86IHGHUDl income tax purposes if at least 75.0% of its gross income for any taxable year consists of ³SDVVLYH
LQFRPH´RUDWOHDVWRIWKHaverage value of its assets produce, or are heldIRUWKHSURGXFWLRQRI³SDVVLYHLQFRPH´)RU purposes
RIWKHVHWHVWV³SDVVLYHLQFRPH´LQFOXGHVGLYLGHQGVLQWHUHVWJDLQVIURPWKHVDOHRUH[FKDQJHRILQYHVWPHQWSURSHUW\DQGUHQWs and
royalties other than rents and royalties that are received from unrelated parties in connection with the active conduct of a trade or
business. For purposes of these tests, income derived from the peUIRUPDQFHRIVHUYLFHVGRHVQRWFRQVWLWXWH³SDVVLYHLQFRPH´U.S.
shareholders of a PFIC are subject to a disadvantageous U.S. federal income tax regime with respect to the income derived by the PFIC,
the distributions they receive from the PFIC, and the gain, if any, they derive from the sale or other disposition of their interests in the
PFIC.
27
Based on our current and projected method of operation, we believe that we were not a PFIC for our 2011 taxable year, and we
expect that we will not be treated as a PFIC for any future taxable year. We believe that (1) more than 25.0% of the income we earn
from our present time chartering activity and more than 50.0% of the assets engaged in generating such income should not be treated as
passive income or assets, respectively, and (2) so long as income from our time charters that we believe should not be treated as passive
income (and any other income that does not constitute passive income) exceeds 25.0% of our gross income for each taxable year after
our initial taxable year and the value of our vessels contracted under such time charters (and any other assets that we believe does not
constitute passive assets) exceeds 50.0% of the average value of all of our assets for each taxable year after our initial taxable year, we
should not be a PFIC for any year. This is based on certain representations and projections regarding our assets, income and charters,
and its validity is conditioned on the accuracy of such representations and projections.
The conclusions that we have reached are not free from doubt and the U.S. Internal Revenue Service (or the IRS) or a court
could disagree with this position. In addition, although we intend to conduct our affairs in a manner to avoid being classified as a PFIC
with respect to each taxable year, we cannot assure unitholders that the nature of our operations will not change in the future and that
we will not become a PFIC in any taxable year. If the IRS were to find that we are or have been a PFIC for any taxable year (and
regardless of whether we remain a PFIC for subsequent taxable years), our U.S. unitholders would face adverse U.S. federal income tax
FRQVHTXHQFHV3OHDVHUHDG³,WHP²$GGLWLRQDO,QIRUPDWLRQ²7D[DWLRQ²0DWHULDO86)HGHUDO,QFRPH7D[&RQVLGHUDWLRQV²86
)HGHUDO,QFRPH7D[DWLRQRI86+ROGHUV²3),&6WDWXVDQG6LJQLILFDQW7D[&RQVHTXHQFHV´IRUDPRUHGHWDLOHGGLVFXVVLRQRIWKH86.
federal income tax consequences to U.S. unitholders if we are treated as a PFIC.
7KHSUHIHUHQWLDOWD[UDWHVDSSOLFDEOHWRTXDOLILHGGLYLGHQGLQFRPHDUHWHPSRUDU\DQGWKHHQDFWPHQWRISUHYLRXVO\SURSRVHG
OHJLVODWLRQFRXOGDIIHFWZKHWKHUGLYLGHQGVSDLGE\XVFRQVWLWXWHTXDOLILHGGLYLGHQGLQFRPHHOLJLEOHIRUWKHSUHIHUHQWLDOUDWH
Certain of our distributions may be treated as qualified dividend income eligible for preferential rates of U.S. federal income
tax to U.S. individual unitholders (and certain other U.S. unitholders). In the absence of legislation extending the term for these
preferential tax rates, all dividends received by such taxpayers in taxable years beginning on January 1, 2013 or later will be taxed at
graduated tax rates applicable to ordinary LQFRPH3OHDVHUHDG³,WHP²$GGLWLRQDO,QIRUPDWLRQ²7D[DWLRQ²0Dterial U.S. Federal
,QFRPH7D[&RQVLGHUDWLRQV²86)HGHUDO,QFRPH7D[DWLRQRI86+ROGHUV²'LVWULEXWLRQV´
:HPD\KDYHWRSD\WD[RQ86VRXUFHLQFRPHZKLFKZRXOGUHGXFHRXUFDVKIORZ
Under the Code, 50.0% of the gross shipping income of a vessel owning or chartering corporation, such as ourselves, that is
attributable to transportation that either begins or ends, but that does not both begin and end, in the United States is characterized as
U.S. source shipping income. U.S. source shipping income generally is subject to a 4.0% U.S. federal income tax without allowance
for deduction unless the corporation qualifies for exemption from tax under Section 883 of the Code and the regulations promulgated
thereunder.
We believe that we and each of our subsidiaries will qualify for this statutory tax exemption for the foreseeable future, and we
will take this position for U.S. federal income tax return reporting purposes. However, there are factual circumstances, including some
that may be beyond our control, that could cause us to lose the benefit of this tax exemption. In addition, our position that we qualify
for this exemption is based upon legal authorities that do not expressly contemplate an organizational structure such as ours;
specifically, although we have elected to be treated as a corporation for U.S. federal income tax purposes, we are organized as a limited
partnership under Marshall Islands law. Therefore, we can give no assurance that the IRS will not take a different position regarding
our qualification, or the qualification of any of our subsidiaries, for this tax exemption.
If we or our subsidiaries are not entitled to this exemption under Section 883 for any taxable year, we or our subsidiaries
generally would be subject to a 4.0% U.S. federal gross income tax on our U.S. source shipping income for such year. Our failure to
qualify for the exemption under Section 883 could have a negative effect on our business and would result in decreased earnings
available for distribution to ouUXQLWKROGHUV3OHDVHUHDG³,WHP²,QIRUPDWLRQRQWKH3DUWQHUVKLS²7D[DWLRQRIWKH3DUWQHUVKLS²The
6HFWLRQ([HPSWLRQ´IRUDPRUHGHWDLOHGGLVFXVVLRQRIWKHrules relating to qualification for the exemption under Section 883 and the
consequences of failing to qualify for such an exemption.
28
8QLWKROGHUVPD\EHVXEMHFWWRLQFRPHWD[LQRQHRUPRUHQRQ86MXULVGLFWLRQVLQFOXGLQJWKH8QLWHG.LQJGRPDVDUHVXOWRI
RZQLQJRXUFRPPRQXQLWVLIXQGHUWKHODZVRIDQ\VXFKMXULVGLFWLRQZHDUHFRQVLGHUHGWREHFDUU\LQJRQEXVLQHVVWKHUH
6XFKODZVPD\UHTXLUHXQLWKROGHUVWRILOHDWD[UHWXUQZLWKDQGSD\WD[HVWRWKRVHMXULVGLFWLRQV
We intend to conduct our affairs and cause or influence each of our subsidiaries to operate its business in a manner that
minimizes income taxes imposed upon us and our subsidiaries and that may be imposed upon a unitholder as a result of owning our
common units. However, because we are organized as a partnership, there is a risk in some jurisdictions, including the United
Kingdom, that our activities or the activities of our subsidiaries may be attributed to our unitholders for tax purposes if, under the laws
of such jurisdiction, we are considered to be carrying on business there. If a unitholder is subject to tax in any such jurisdiction, such
XQLWKROGHUPD\EHUHTXLUHGWRILOHDWD[UHWXUQZLWKDQGWRSD\WD[LQWKDWMXULVGLFWLRQEDVHGRQVXFKXQLWKROGHU¶VDOORFDEOH share of
our income. We may be required to reduce distributions to a unitholders on account of any tax withholding obligations imposed upon
us by that jurisdiction in respect of such allocation to such unitholder. The United States may not allow a tax credit for any foreign
income taxes that a unitholder directly or indirectly incurs by virtue of an investment in us.
We believe we can conduct our affairs in a manner that does not result in our unitholders being considered to be carrying on
business in the United Kingdom solely as a consequence of the acquisition, ownership, disposition or redemption of our common
units. However, the question of whether either we or any of our subsidiaries will be treated as carrying on business in any jurisdiction,
including the United Kingdom, will be largely a question of fact to be determined through an analysis of contractual arrangements,
including the fleet management agreements that our subsidiaries have entered into with Golar Management, certain other subsidiaries
of Golar and certain third-party vessel managers and the management and administrative service agreement that we have entered into
with Golar Management, as well as through an analysis of the manner in which we conduct business or operations, all of which may
change over time. Furthermore, the laws of the United Kingdom or any other jurisdiction may also change, which could cause that
jXULVGLFWLRQ¶VWD[LQJDXWKRULWLHVWRGHWHUPLQHWKDWZHDUHFDUU\LQJRQEXVLQHVVLQVXFKMXULVGLFWLRQDQGWKDWZHRURXUXQLWKROGers are
subject to its taxation laws. In addition to the potential for taxation of our unitholders, any additional taxes imposed on us or any of
our subsidiaries will reduce our cash available for distribution.
Item 4. Information on the Partnership
A. History and Development of the Partnership
We are a publicly traded limited partnership formed as a wholly owned subsidiary of Golar LNG Limited (NASDAQ:
GLNG), a leading independent owner and operator of Floating StorDJH5HJDVLILFDWLRQ8QLWV³)658V´) and LNG carriers, to own and
operate FSRUs and LNG carriers under long-term charters. Upon our formation, Golar contributed to us a 100% interest in certain
subsidiaries which owned a 60% interest in the *RODU0D]R and which leased the *RODU6SLULW and the 0HWKDQH3ULQFHVV. In
April 2011, we completed our IPO of 13.8 million common units. In connection with our IPO, Golar transferred to us a 100% interest
in the subsidiary which leases the *RODU:LQWHU and the legal title to the *RODU6SLULW. In this Annual Report, we refer to the four
vessels that were contributed to us in connection with our formation and our IPO as our initial fleet. In October 2011, we completed
the acquisition of 100% interests in subsidiaries that own and operate the FSRU, the *RODU)UHH]H from Golar for a purchase price of
approximately $330 million less assumed bank debt of $108 million. In this Annual Report, we refer to the vessels in our initial fleet
and the *RODU)UHH]H, collectively, as our current fleet. As of April 20, 2012, we have a fleet of three FSRUs and two LNG carriers.
We are incorporated under the laws of the Marshall Islands and maintain our principal executive headquarters at Par-La-Ville
Place, 14 Par-la-Ville Road, Hamilton, HM08, Bermuda. Our telephone number at that address is +1 (441) 295-4705. Our principal
administrative offices are located at 13th Floor, One America Square, 17 Crosswall, London EC3N 2LB, United Kingdom.
29
B. Business Overview
General
Our business is to own and operate FSRUs and LNG carriers under long-term time charters (which we define as charters with
terms of five or more years). Our primary business objective is to increase quarterly distributions per unit over time by growing our
business through accretive acquisitions of FSRUs and LNG carriers and by chartering our vessels pursuant to long-term charters with
high quality customers that generate long-term stable cash flows. The vessels in our current fleet are chartered to BG Group,
Pertamina, Petrobras and Dubai Supply Authority under long-term time charters that had an average remaining term of 9 years as of
March 31, 2012. Since our IPO in April 2011, we have increased our quarterly distribution from $0.385 per unit paid on a prorated
basis for the period from the closing of our IPO through June 30, 2011, to $0.43 per unit for the quarter ended December 31, 2011.
We intend to leverage the relationships, expertise and reputation of Golar, a leading independent owner and operator of
FSRUs and LNG carriers, to pursue potential growth opportunities and to attract and retain high-quality, creditworthy customers. As
of April 20, 2012, Golar owned our 2.0% general partner interest, all of our incentive distribution rights and a 63.4% limited partner
interest in us. Golar intends to utilize us as its primary growth vehicle to pursue the acquisition of long-term stable cash flow
generating FSRUs and LNG carriers.
Business Strategies
Our primary business objective is to increase quarterly distributions per unit over time by executing the following strategies:
d 3XUVXHVWUDWHJLFDQGDFFUHWLYHDFTXLVLWLRQVRI)658VDQG/1*FDUULHUV We believe our affiliation with Golar positions us
to pursue a broader array of growth opportunities, including strategic and accretive acquisitions from Golar, with Golar or
from third parties.
d &RPSHWHIRUORQJWHUPFKDUWHUFRQWUDFWVIRU)658VDQG/1*FDUULHUVZKHQDWWUDFWLYHRSSRUWXQLWLHVDULVH We intend to
participate in competitive tender processes and engage in negotiated transactions with potential charterers for both FSRUs
and LNG carriers when attractive opportunities arise by leveraging the strength of the industry expertise of Golar and the
Fredriksen Group, as well as our publicly traded partnership status.
d 0DQDJHRXUIOHHWDQGRXUFXVWRPHUUHODWLRQVKLSVWRSURYLGHDVWDEOHEDVHRIFDVKIORZVDQGVXSHULRURSHUDWLQJ
SHUIRUPDQFH We intend to manage the stability of cash flows in our fleet by actively seeking the extension or renewal of
existing charters, entering into new long-term charters with current customers and identifying potential business opportunities
with new high-quality charterers.
We can provide no assurance, however, that we will be able to implement our business strategies described above. For further
discussion of the risks that ZHIDFHSOHDVHUHDG³,WHP².Hy InformaWLRQ²5LVN)DFWRUV´
The Natural Gas Industry
Predominately used to generate HOHFWULFLW\DQGDVDKHDWLQJVRXUFHQDWXUDOJDVLVRQHRIWKH³ELJWKUHH´IRVVLOIXHOVWKDWPDNe
up the vast majority of world energy consumption. As a cleaner burning fuel than both oil and coal, natural gas has become an
increasingly attractive fuel source in the last decade. As more emphasis is placed on reducing carbon emissions, Organization for
Economic Cooperation and Development (or OECD) nations have come to view natural gas as a way of reducing their environmental
footprint, particularly for electricity where natural gas-fired facilities have been gradually replacing oil, coal and older natural gas-
fired plants.
Natural gas is an abundant fuel source, with the EIA estimating that, as of January 1, 2011, worldwide proved natural gas
reserves were 6,675 Tcf (189,014 bcm). AlPRVWWKUHHTXDUWHUVRIWKHZRUOG¶VQDWXUDOJDs reserves are located in the Middle East and
Eurasia. Russia, Iran and Qatar accounted for 54RIWKHZRUOG¶VQDWXUDOJDVUHVHUYHVDV of January 1, 2011, and the United States is
the fifth largest holder of natural gas reserves at 4.1% of the
30
ZRUOG¶VUHVHUYHV
The EIA predicts a substantial inFUHDVHLQWKHSURGXFWLRQRI³XQFRQYHQWLRQDO´QDtural gas, including tight gas, shale gas and
coalbed methane. Although reserves of unconventional natural gas are unknown, the EIA predicts a substantial increase in natural gas
supplies from unconventional formations in the future, especially from the United States but also from Canada, France, Poland,
Turkey, Ukraine, South Africa, Morocco, Chile, Mexico, China, Australia, Libya, Algeria, Argentina and Brazil. Shale gas production
has been particularly prolific increasing by over 5 billion cubic feet (or Bcf) per day since the beginning of 2007. This increase
largely results from recent advances in horizontal drilling and hydraulic fracturing technologies, especially in the U.S. These
WHFKQRORJLHVKDYHPDGHLWSRVVLEOHWRH[SORLWWKH86¶VYDVWVKale gas resources. Rising estimates of shale gas resources have helped
to increase estimates of the total U.S. natural gas reserves by almost 50% over the past decade. The EIA expects shale gas to comprise
47% of U.S. natural gas production in 2035.
The reduced rate of growth in LNG demand in the U.S. is expected to be at least partly offset by increased demand for LNG
in other nations, especially non-OECD countries.
Liquefied Natural Gas
Overview
The need to transport natural gas over long distances across oceans led to the development of the international LNG trade.
The first shipments were made on a trial basis in 1959 between the United States and the United Kingdom, while 1964 saw the start of
the first commercial-scale LNG project to ship LNG from Algeria to the United Kingdom. LNG shipping provides a cost-effective
and safe means for transporting natural gas overseas. The LNG is transported overseas in specially built tanks on double-hulled ships
to a receiving terminal, where it is offloaded and stored in heavily insulated tanks. In regasification facilities at the receiving terminal,
the LNG is returned to its gaseous state (or regasified) and then shipped by pipeline for distribution to natural gas customers.
The LNG supply chain involves the following components:
*DV)LHOG3URGXFWLRQDQG3LSHOLQH Natural gas is produced and transported via pipeline to natural gas liquefaction facilities
located along the coast of the producing country.
/LTXHIDFWLRQ3ODQWDQG6WRUDJH Natural gas is cooled to a temperature of minus 260 degrees Fahrenheit, transforming the
gas into a liquid, which reduces its volume to approximately 1/600th of its volume in a gaseous state. The reduced volume facilitates
economical storage and transportation by ship over long distances, enabling countries with limited natural gas reserves or limited
access to long-distance transmission pipelines to meet their demand for natural gas.
6KLSSLQJ LNG is loaded onto specially designed, double-hulled LNG carriers and transported overseas from the liquefaction
facility to the receiving terminal.
5HJDVLILFDWLRQ At the regasification facility (either onshore or aboard specialized LNG carriers), the LNG is returned to its
gaseous state, or regasified.
6WRUDJH'LVWULEXWLRQDQG0DUNHWLQJ Once regasified, the natural gas is stored in specially designed facilities or transported
to natural gas consumers and end-use markets via pipelines.
According to Wood Mackenzie LNG liquefaction capacity was 175 million tones per annum in 2007, this increased to 242
million tonnes per annum by 2011 and is expected to increase to approximately 280 millions tonnes by 2015.
31
7KH/1*&DUULHU)OHHW
As of end March 2012, the world LNG carrier fleet consisted of 367 LNG carriers (including FSRUs and Regasification
Vessels and 8 vessels currently in Lay-up). By end March 2012, there were orders for 79 new LNG carriers (including 6 FSRUs, 1
small vessel with a capacity of 15,600m3 and 2 production units), with the bulk of ordered vessels not expected to deliver until 2013-
2014.
While there are a number of different types of LNG vessels anG³FRQWDLQPHQWV\VWHPV´WKHUHare two dominant containment
systems in use today:
d The 0RVV system was developed in the 1970s and uses free standing insulated spherical tanks supported at the
equator by a continuous cylindrical skirt. In this system, the tank and the hull of the vessel are two separate
structures.
d The 0HPEUDQH system uses insulation built directly into the hull of the vessel, along with a membrane covering
inside the tanks to maintain their integrity. In this systHPWKHVKLS¶VKXOOGLUHFWO\VXSSRUWVWKHSUHVVXUHRIWKH/1*
cargo.
Of the vessels currently trading and on order, approximately 72% employ the membrane containment system, 26% employ
the Moss system and the remaining 2% employ other systems. Of the newbuilds, vessels on order that have employed the membrane
containment system, have done so primarily because it most efficiently utilizes thHHQWLUHYROXPHRIDVKLS¶VKXOO7KHFRQVWUXction
period for an LNG carrier is approximately 28-34 months.
Propulsion systems also differ. Historically most ships were built with steam turbine propulsion whereas most current
newbuilds have been ordered with more efficient tri-fuel diesel electric engines. Most LNG carriers can use the natural boil off of gas
from LNG to power the vessel.
Seasonality
Historically, LNG trade, and therefore charter rates, increased in the winter months and eased in the summer months as
demand for LNG in the Northern Hemisphere rose in colder weather and fell in warmer weather. The tanker industry in general has
become less dependent on the seasonal transport of LNG than a decade ago as new uses for LNG have developed, spreading
consumption more evenly over the year. There is a higher seasonal demand during the summer months due to energy requirements for
air conditioning in some markets and a pronounced higher seasonal demand during the winter months for heating in other markets.
Floating LNG Regasification
)ORDWLQJ/1*6WRUDJHDQG5HJDVLILFDWLRQ9HVVHOV
Floating LNG regasification vessels are commonly known as FSRUs. The FSRU regasification process involves the
vaporization of LNG and injection of the resultant natural gas directly into one or more pipelines. In order to regasify LNG, FSRUs
are equipped with vaporizer systems that can operate in the open-loop mode, the closed-loop mode or in both modes. In the open-loop
mode, seawater is pumped through the system to provide the heat necessary to convert the LNG to the vapor phase. In the closed-loop
system, a natural gas-fired boiler is used to heat water circulated in a closed-loop through the vaporizer and a steam heater to convert
the LNG to the vapor phase. In general, FSRUs can be divided into four subcategories:
d FSRUs that are permanently located offshore;
d FSRUs that are permanently alongside (with LNG transfer being either directly ship to ship or over a jetty);
32
d shuttle carriers that regasify and discharge their cargos offshore (sometimes referred to as energy bridge); and
d shuttle carriers that regasify and discharge their cargos alongside.
*RODU¶VDQGWKH3DUWQHUVKLS¶VEXVLQHVVPRGHOWRGDWHKDVEHHQfocused on FSRUs that are permanently offshore or alongside
and focused on continuous regasification service.
'HPDQGIRU)ORDWLQJ/1*5HJDVLILFDWLRQ)DFLOLWLHV
The long-term outlook for global natural gas supply and demand has stimulated growth in LNG production and trade, which
is expected to drive a necessary expansion of regasification infrastructure. While worldwide regasification exceeds worldwide
liquefaction capacity, a large portion of the existing global regasification capacity is concentrated in a few markets such as Japan,
Korea and the U.S. Gulf Coast. There remains a significant demand for regasification infrastructure in growing economies in Asia,
Middle-East and Central/South America. We believe that the advantages of FSRUs compared to onshore facilities make them highly
competitive in these markets.
Floating LNG regasification projects first emerged as a solution to the difficulties and protracted nature of obtaining
permission to build shore-based LNG reception facilities (especially along the North American coasts). Due to their offshore location,
floating facilities are less likely than onshore facilities to be met with resistance in local communities, which is especially important in
the case of a facility that is intended to serve a highly populated area where there is a high demand for natural gas. As a result, it is
typically easier and faster for FSRUs to obtain necessary permits than for comparable onshore facilities. More recently, cost and time
have become the main drivers behind the growing interest in the various types of floating LNG regasification projects.
In addition, the flexibility afforded by floating LNG regasification facilities provide an advantage over onshore facilities. A
floating regasification vessel can load, store and regasify LNG before delivering the natural gas to market. It can be operated partially
as a conventional trading ship that transports and regasifies its own cargo, or as a mother-ship that processes supplies received by way
of ship-to-ship transfers. FSRUs can also be moved to (and operated at) a different location if required, which is particularly beneficial
in markets where demand for LNG is seasonal. Additionally, FSRUs offer quicker access to LNG supply for markets that lack onshore
regasification infrastructure. The FSRU can be a substitute for a land based terminal and remain a fixed and permanent facility over
the long term but can also complement land based regasification by providing storage and regasification to a market while the longer
lead time land based terminal is being constructed.
)ORDWLQJ/1*5HJDVLILFDWLRQ9HVVHO)OHHW6L]HDQG2ZQHUVKLS
Compared to onshore terminals, the floating LNG regasification industry is fairly young. There are only a limited number of
companies, including Golar as well as Exmar, Excelerate Energy, and Hoegh LNG that are operating FSRU terminals for LNG
importers around the world. In this regard, Golar was the first company to enter into an agreement for the long-term employment of an
FSRU based on the conversion of an existing LNG carrier.
As of February 2012, there are 13 FSRU vessels in existence with an additional 8 FSRUs under construction.
FSRUs can have some potential disadvantages. While FSRUs can have comparable ability to offload cargo from LNG
carriers relative to land based terminals, land based terminals typically have greater storage capacity which can facilitate faster cargo
offload in a situation when storage tanks are partially full. Land based terminals are also potentially better suited for large gas send out
capacity requirements in excess of the capacity of the largest FSRUs.
&RPSHWLWLRQ²/1*Carriers and FSRUs
While the majority of the existing world LNG carrier fleet is employed on long-term charters, there is competition for the
employment of vessels whose charters are expiring and for the employment of vessels which are not dedicated to a long-term
contract. Competition for mid- and long-term LNG charters is based primarily on
33
price, vessel availability, size, age and condition of the vessel, relationships with LNG carrier users and the quality, LNG experience
and reputation of the operator. In addition, vessels may operate in the emerging LNG carrier spot market that covers short-term
charters of one year or less. Recent market developments have seen a considerable tightening in the supply/demand balance leading to
a sharp increase in employment and hire rates.
7RJHWKHUZLWK*RODUZHEHOLHYHWKDWZHDUHRQHRIWKHZRUOG¶VODUJHVWLQGHpendent LNG carrier and FSRU owner and
operators.
We compete with other independent shipping companies who also own and operate LNG carriers. While there are some
barriers to entry, including the cost of an LNG carrier and expertise, new entrants have entered the market over the last five years.
In addition to independent LNG operators, some of the major oil and gas producers, including Royal Dutch Shell, BP, and
BG own LNG carriers and have in the recent past contracted for the construction of new LNG carriers. National gas and shipping
companies also have large fleets of LNG vessels that have expanded and will likely continue to expand. These include Malaysian
International Shipping Company, or MISC, National Gas Shipping Company located in Abu Dhabi and Qatar Gas Transport
Company, or Nakilat.
FSRUs are in an early stage of their commercial development and thus there is less competition in that market than in the
more mature commercial market of LNG carriers. There are currently a very limited number of FSRU owner / operators, in addition
to us, made up of Excelerate Energy, an Exmar/Teekay joint venture, and Hoegh LNG.
Our Fleet and Customers
Our current fleet consists of:
d a 100% interest in the *RODU6SLULW, an FSRU retrofitted in 2007 from an LNG carrier built in 1981 that is currently
operating under a time charter that expires in 2018 with Petrobras, the majority state-owned oil and gas company of
Brazil;
d a 100% interest in the *RODU:LQWHU, an FSRU retrofitted in 2008 from an LNG carrier built in 2004 that is currently
operating under a time charter that expires in 2024 with Petrobras;
d a 100% interest in the *RODU)UHH]H, an FSRU retrofitted in 2010 from an LNG carrier built in 1977 that is currently
operating under a time charter that expires in 2020 with DUSUP, the exclusive purchaser of natural gas in Dubai.
d a 100% interest in the 0HWKDQH3ULQFHVV, an LNG carrier built in 2003 that is currently operating under a time charter
that expires in 2024 with BG Group; and
d a 60% interest in the *RODU0D]R, an LNG carrier built in 2000 that is currently operating under a time charter that
expires in 2017 with Pertamina, the state-owned oil and gas company of Indonesia.
We intend to leverage our relationship with Golar to make additional accretive acquisitions of FSRUs and LNG carriers with
long-term charters from Golar and third parties. For example, pursuant to the omnibus agreement, wehave the right to purchase from
Golar the1XVDQWDUD5HJDV6DWX, an LNG carrier built in 1977, following the completion of its FSRU retrofitting and acceptance by its
charterer, which is expected to occur in the second quarter of 2012. The 1XVDQWDUD5HJDV6DWX is expected to operate under an 11-
year time charter with Nusantara Regas for the West Java LNG project in Indonesia. Nusantara Regas is a joint venture that is 60%
owned by Pertamina and 40% owned by the Indonesian distribution firm PT Perusahaan Gas Negara.
34
)658V
The following table provides information about the three FSRUs in our current fleet:
FSRU Vessel
Capacity
(cbm)
Offtake
Capacity
(Bcf/d)
Year of
Delivery
Post-Retrofit
Charter
Commencement
Our Interest
Charterer
Charter
Expiration
*RODU6SLULW
*RODU:LQWHU
128,000
138,000
0.25
0.50
1981
2004
July 2008
September 2009
100% Petrobras
100% Petrobras
2018
2024
*RODU)UHH]H
Total Capacity
125,000
391,000
1977
0.48
1.23
May 2010
100%
DUSUP
2020
Charter
Extension
Option
Periods
Three years
plus two
years
none
Terms
extending
up to 2025
(1)
(1) DUSUP has the option to extend the charter for two extension periods of two years and two years. DUSUP has an option to extend the initial
term or either of the extension periods by one year.
*RODU6SLULWThe *RODU6SLULW utilizes a closed-loop regasification system. The *RODU6SLULW is operating under a 10-year
time charter to Petrobras, which is the largest energy company in Brazil with an integrated structure consisting of oil and oil by-
product exploration, production, refining, marketing, and transportation.
Petrobras currently operates the *RODU6SLULW in northeastern Brazil at the port of Pecem, where it is moored at a jetty in
sheltered waters behind a breakwater, delivering regasified LNG through a hard arm connection directly into a pipeline that services
base load power generating assets. The *RODU6SLULW has the ability to operate as a traditional LNG carrier.
The *RODU6SLULW was built in 1981. Given that the *RODU6SLULWis principally operated in a stationary location and given the
non-corrosive nature of LNG, we believe that its useful post-retrofit service life will be extended by ten years in excess of its initial
40-year useful life.
*RODU:LQWHUThe *RODU:LQWHU was delivered to Golar LNG in 2004. The *RODU:LQWHU is currently operating under a 10-
year time charter to Petrobras. In January 2012, we agreed to make certain modifications to the *RODU:LQWHU in return for an increase
in the charter rate and an extension in the contract term by five years.
The *RODU:LQWHU utilizes a regasification system able to operate in both open- and closed-loop modes. From the time that it
commenced service as an FSRU, the *RODU:LQWHU was operated at an island jetty in Guanabara Bay outside Rio de Janeiro where it
was moored at a jetty in sheltered waters behind a breakwater, delivering regasified LNG through a hard arm connection directly into
a pipeline that services base load power generating assets. In January 2012, Petrobras elected to move the *RODU:LQWHU from Rio de
Janeiro to Bahia, requiring certain modifications, including the addition of LNG loading arms. The Partnership has agreed to make
these modifications in return for an increase in the charter rate and an extension in the contract term by 5 years. The *RODU:LQWHU is
employed by Petrobras as an FSRU to service peak load power requirements.
*RODU)UHH]H. The *RODU)UHH]H was delivered to Golar in 1977 and Golar operated the vessel as an LNG carrier until
commencement of its retrofitting. The *RODU)UHH]H completed its retrofitting in May 2010 and is currently operating as an FSRU
under a time charter with DUSUP, the exclusive purchaser of natural gas in Dubai, that expires in 2020.
The *RODU)UHH]H is permanently moored alongside a purpose built jetty within the existing Jebel Ali port. The *RODU)UHH]H
is capable of storing and delivering regasified LNG to DUSUP for further delivery into the Dubai gas network.
35
The *RODU)UHH]H was built in 1977. Given that the *RODU)UHH]His principally operated in a stationary location and given
the non-corrosive nature of LNG, we believe that its useful post-retrofit service life will be extended by ten years in excess of its initial
40-year useful life.
2XU2SWLRQWR3XUFKDVHWKH1XVDQWDUD5HJDV6DWXUnder the omnibus agreement, we have the right to purchase the
1XVDQWDUD5HJDV6DWXIURP*RODUXSRQWKHFRPSOHWLRQRIWKHYHVVHO¶VUHWURILtting and acceptance by its charterer at a price equal to its
fair market value. The fair market value of the 1XVDQWDUD5HJDV6DWXwill be determined through negotiations with Golar or, if we
and Golar are unable to agree as to the fair market value of the 1XVDQWDUD5HJDV6DWX, by a mutually acceptable investment banking
firm, ship broker or other expert advisor in accordance with the omnibus agreement. The fair market value of the 1XVDQWDUD5HJDV
6DWX, as finally determined, may be an amount that is greater than what we are able or willing to pay. We will not be obligated to
purchase the 1XVDQWDUD5HJDV6DWXat the determined price, and, accordingly, we may not complete the purchase of the 1XVDQWDUD
5HJDV6DWX.
The 1XVDQWDUD5HJDV6DWXwas delivered to Golar in 1977. The 1XVDQWDUD5HJDV6DWXhas a capacity of 125,000 cbm and
will have a maximum offtake capacity of 0.5 Bcf per day. Golar operated the 1XVDQWDUD5HJDV6DWXas an LNG carrier prior to its
UHWURILWWLQJLQWRDQ)658)ROORZLQJFRPSOHWLRQRIWKHYHVVHO¶s retrofitting and acceptance by its charterer, which is expected to be in
the second quarter of 2012, the 1XVDQWDUD5HJDV6DWX is expected to operate under an 11-year time charter with Nusantara Regas for
the West Java FSRU Project.
/1*&DUULHUV
The following table provides additional information about our two LNG carriers:
LNG Carrier
*RODU0D]R
0HWKDQH3ULQFHVV
Capacity
(cbm)
135,000
138,000
Year of
Delivery
2000
2003
Our
Interest
Charterer
60%(1) Pertamina
Current
Charter
Expiration
2017
100% BG Group
2024
Total Capacity
273,000
Charter Extension
Option Periods
Five years plus
five years
Five years plus
five years
(1) Chinese Petroleum Corporation holds the remaining 40% interest in the *RODU0D]R.
As of March 31, 2012, our LNG carriers had an average age of 10 years, compared to the world LNG carrier fleet average
age of approximately 11 years. LNG carriers are generally expected to have a lifespan of approximately 40 years. The *RODU0D]R
has a Moss containment system, while the 0HWKDQH3ULQFHVV has a membrane-type cargo containment system. Our charterers are able
to use our LNG carriers worldwide or to sublet the vessels to third parties.
*RODU0D]RThe *RODU0D]R is currently chartered to Pertamina. Founded in 1960, Pertamina is the state-owned oil and
gas company in Indonesia and one of the worlG¶VODUJHVWSURGXFHUVDQGH[SRUWHUVRI/1*
0HWKDQH3ULQFHVVThe 0HWKDQH3ULQFHVV is currently chartered to BG Group. BG Group engages in exploration and
production of gas and oil reserves, export, shipping and import of LNG, pipeline transmission and distribution of gas, and various gas-
powered electricity generation projects. BG Group operates in 23 countries on five continents. BG Group operates in the Atlantic
Basin, with liquefaction and/or regasification activities on stream or in development in Chile, Egypt, Italy, Nigeria, the United
Kingdom and the United States.
FSRU Charters
We provide the services of each of the *RODU6SLULW and the *RODU:LQWHUto Petrobras under separate Time Charter Parties (or
TCP) and Operation and Services Agreements (or OSAs). The TCPs and OSAs are interdependent and when combined have the same
effect as the time charters for our LNG carriers. The services of the *RODU)UHH]H are provided to DUSUP under a TCP. If we
exercise our right to purchase the 1XVDQWDUD5HJDV6DWX from Golar, we will provide the services of the 1XVDQWDUD5HJDV6DWX to
Nusantara Regas under a TCP.
36
The *RODU6SLULW, *RODU:LQWHU and *RODU)UHH]Hcharters feature hire and off-hire provisions similar to those provisions in
the charters for our LNG carriers. The *RODU6SLULW and *RODU:LQWHUcharters also contained provisions giving Petrobras the option to
purchase the vessels from us under certain circumstances. Following our agreement to make certain modifications to the *RODU:LQWHU
LQ-DQXDU\3HWUREUDV¶RSWLRQWRSXUFKDVHWKH*RODU6SLULWand *RODU:LQWHU have been cancelled. The *RODU6SLULW, *RODU:LQWHU
and *RODU)UHH]H charters have additional requirements that the vessels are able to receive LNG from another LNG carrier within a
specified time and then to discharge regasified LNG at a specified pressure and flow rate. The following discussion describes the
material terms of the *RODU6SLULW, *RODU:LQWHU and *RODU)UHH]Hcharters.
,QLWLDO7HUP([WHQVLRQV
The *RODU6SLULW charter commenced upon acceptance by Petrobras in July 2008. The charter has an initial term of 10 years.
Petrobras has the option to extend the charter for two extension SHULRGVRIWKUHH\HDUVDQGWZR\HDUV6L[PRQWKV¶QRWLFHLVUequired if
any extension option is to be exercised by Petrobras. If Petrobras exercises its option to extend the *RODU6SLULW charter beyond its
initial term, the hire rate will be reduced by approximately 5.0%.
The *RODU:LQWHUcharter commenced upon acceptance by Petrobras in September 2009. The charter had an initial term of
ten years. Petrobras is planning to move the *RODU:LQWHU from its present site in Rio de Janeiro to Bahia and as a consequence the
vessel will require certain modifications including the addition of LNG loading arms. We have agreed to make these modifications in
return for an increase in the charter rate and a 5-year extension to the contract term. The vessel is due to be delivered at its new site in
the third quarter of 2013 at which point the new charter rate will commence.
The *RODU)UHH]H charter commenced upon acceptance by DUSUP in May 2010. The charter has an initial term of ten
years. Under the *RODU)UHH]H charter, DUSUP has the option to extend the charter for two extension periods of two years each and
has the option to increase the length of the initial term or one RIWKHH[WHQVLRQSHULRGVE\RQH\HDU6L[PRQWKV¶QRWLFHLVUequired if an
extension option is to be exercised by DUSUP. If DUSUP exercises its option to extend the *RODU)UHH]H charter beyond its initial
WHUPWKHIL[HGFRPSRQHQWRIWKHKLUHUDWHZLOOEHUHGXFHGE\DSSUR[LPDWHO\6HH³²+LUH5DWH´
+LUH5DWH
Under the TCP for the *RODU6SLULWand the *RODU:LQWHU, hire is payable monthly, in advance in U.S. Dollars. The TCP
provides for the capital cost component of the charter, which relates to the cost of WKHYHVVHO¶VSXUFKDVHDQGLVVWUXFWXUHGWR meet that
cost and provide a return on investor capital. The TCP also provides for all drydocking and insurance-related costs. The hire amount
payable under the TCP was established between the parties at the time the charter was entered into and will be increased based on a
specified cost-of-living index on a bi-annual basis.
Under the OSA for the *RODU6SLULW and the *RODU:LQWHU, hire is payable monthly in advance in Brazilian Reais. The hire
payable under the OSA covers the operating cost component of the charter and covers all vessel operating expenses, other than
drydocking and insurance. The hire amount payable under the OSA was established between the parties at the time the charter was
entered into and will be increased based on a specified mix of cost-of-living and U.S. Dollar foreign exchange rate indices on an
annual basis.
Under the *RODU)UHH]H charter, hire is payable monthly, in advance in U.S. Dollars. The hire payable under the charter
consists of two components, a fixed charter hire rate and an operating cost element. The fixed rate component will remain constant for
the duration of the initial term of ten years. If DUSUP exercises its option to extend the charter beyond its initial term, the fixed hire
rate component for any such extension term will be reduced by approximately 64.4% from the initial hire rate. The operating cost
component includes all vessel operating expenses, except drydocking and certain insurance costs. The operating cost element is reset
each year in order to take cost increases into account.
The hire rate payable for the *RODU6SLULW, the *RODU:LQWHUandthe *RODU)UHH]H may be reduced if they do not perform to
certain of their specifications, such as specified rates of regasification.
37
([SHQVHV
Under the *RODU6SLULW*RODU)UHH]H and *RODU:LQWHU charters, the vessel owner is responsible for FSRU operating
expenses, which include crewing, repairs and maintenance, insurance, stores, lube oils and communication expenses as well as
periodic drydocking costs. The vessel owner is also directly responsible for providing all of these items and services. The charterer
generally pays the voyage expenses, which include all expenses relating to particular voyages, including any bunker fuel expenses,
LNG boil-off, port fees, cargo loading and unloading expenses, canal tolls, agency fees and commissions. The charterer is responsible
for providing, maintaining, repairing and operating certain facilities at the unloading port such as sufficient mooring infrastructure for
LNG ships to be berthed alongside and a high pressure send-out pipeline.
2IIKLUH
The vessel owner is responsible for all costs when the FSRU is off-hire. Prolonged off-hire may lead to termination of the
time charter. A vessel generally will be deemed off-hire if there is a specified time it is unavailable for use by the customer due to the
factors described above under ³²/1*&DUULHU&KDUWHUV²2IIKLUH´8QGHUWKH26$VIRUWKH*RODU6SLULW and the *RODU:LQWHU, an
off-hire allowance is provided for a certain number of hours of scheduled off-hire per year. Under the *RODU)UHH]H charter the vessel
owner is allowed a certain number of days to carry out periodic drydocking during which time the vessel will not be offhire.
6KLS0DQDJHPHQWDQG0DLQWHQDQFH
Under the *RODU6SLULW, the *RODU:LQWHU and *RODU)UHH]H charters, the vessel owner is responsible for the technical
management of the vessels, including engagement and provision of qualified crews, maintaining the vessel, arranging supply of stores
and equipment, periodic drydocking, cleaning and painting and ensuring compliance with applicable regulations, including licensing
and certification requirements. Golar Management and Golar Wilhelmsen provide these management services under the fleet
management agreements.
We are focused on operating and maintaining our vessels to the highest safety and industry standards and at the same time
maximizing revenue from each vessel. It is our policy to have our crews perform planned maintenance on our vessels while
underway, to reduce time required for repairs during drydocking. This reduces the overall off-hire period required for dockings and
repairs. We believe that the additional revenue earned from reduced off-hire periods outweighs the expense of the additional crew
members or sub-contractors.
During their retrofitting, the FSRUs were prepared for five years in service between drydockings. This is in line with the
policy adopted by the industry for new LNG carriers. The *RODU6SLULW, the *RODU:LQWHU and the *RODU)UHH]H will benefit from the
significantly reduced loads and wear and tear associated with remaining in sheltered waters for the majority of the terms of their
charters.
7HUPLQDWLRQ
The *RODU6SLULW and *RODU:LQWHU charters will terminate automatically, or immediately upon receipt of written notice from
Petrobras upon loss of the relevant vessel. In addition, the vessel owner is generally entitled to suspend performance (but with the
FRQWLQXLQJDFFUXDOWRWKHYHVVHORZQHU¶VEHQHILt of hire payments and default interest) and/or terminate the charter if Petrobras defaults
in its payment obligations under the applicable charter. Under the *RODU6SLULW and the *RODU:LQWHU charters, either party may also
terminate the charter for force majeure after a continuous and specified period or in the event that war or hostilities materially and
adversely affect the trading of the applicable vessel. Additionally, either party may elect to terminate either of the charters upon the
occurrence of specified events of default. Petrobras will have the right to terminate the *RODU6SLULW and the *RODU:LQWHU charters in
the event of requisition by any governmental authority. Petrobras has the right to terminate the charters for continuing off-hire
reasons. Petrobras also has the right to terminate the *RODU6SLULW and the *RODU:LQWHU charters, after the fifth and tenth anniversary,
respectively, of the commencement of the applicable charter without fault upon payment of a termination fee specified in the relevant
FKDUWHU6L[PRQWKV¶QRWLFHLVUHTXLUHGLI3HWUREUDVZLVKHVWRexercise its right to no fault termination under either of the charters.
Under the *RODU)UHH]H charter, DUSUP may terminate the agreement immediately, upon giving written notice to the owner,
in the event of the loss of the vessel or in the event that the vessel is off-hire for a specified
38
extended period. The charterer may terminate the agreement where force majeure circumstances result in minimal receipt of gas or
minimal regasification conditions that continue uninterrupted for a specified period, upon written notice to the owner. In addition,
either party may terminate the charter in the event that war or hostilities continue for a specified period of time and are likely to
materially and adversely affect the operations of the vessel. Additionally, either party may elect to terminate the charter upon the
occurrence of specified events of default, after written notice. The charterer will have the right to terminate the Golar Freeze charter
in the event of requisition by any governmental authority. The charterer also has the right to terminate the charter without fault after
the fifth anniversary of the commencement of the charter upon six months prior written notice and payment of a compensatory fee.
We may terminate the agreement with immediate effect in the event that the charterer is in default of its payment obligations under the
agreement after the owner has furnished notice of default to the charterer.
A termination of any of our FSRU charters could have a material adverse effect on our business, results of operations and
financial condition and could significantly reduce our ability to make distributions to our unitholders. However, in the event of a
contract termination of any of our FSRUs charters, we believe, based on current market conditions, that we would likely be able to re-
charter any of our FSRU vessels at rates not significantly dissimilar to the charter rates under our existing FSRU charters without a
significant impact to our net cash flow. We cannot guarantee this outcome.
LNG Carrier Charters
We provide the LNG marine transportation services of the Golar Mazo and the Methane Princess under time charters with
Pertamina and BG Group, respectively. A time charter is a contract for the use of the vessel for a fixed period of time at a specified
daily rate. Under a time charter, the vessel owner provides crewing and other services related WRWKHYHVVHO¶VRSHUDWLRQWKHcost of
which is included in the daily rate, and the customer is responsible for substantially all of the vessel voyage costs (including fuel, port
and canal fees and LNG boil-off). The following discussion describes the material terms of our LNG carrier time charters.
Initial Term; Extensions
Golar Mazo. The initial term of the charter with Pertamina began upon delivery of the vessel in January 2000 and will
terminate during the fourth quarter of 2017. Pertamina has the option to extend the charter of the Golar Mazo for up to 10 years by
exercising the right to extend for one or two additional five-year SHULRGV3HUWDPLQDPXVWSURYLGHWZR\HDUV¶QRWLFHRIDQ\GHcision to
extend. In addition, Pertamina has the right to one additional short-term extension of two to 12 months following either the initial
SHULRGRIWKHFKDUWHURUDQH[WHQVLRQSHULRGXSRQGD\V¶QRWLFH
Methane Princess. The initial term of the Methane Princess charter with BG Group commenced in 2004 and will terminate
during the first quarter of 2024. This charter is subject to an outstanding option on the part of BG Group to extend the charter for one
or two five-year periods by prRYLGLQJPRQWKV¶QRWLFHSULRUWR the end of each period. The Methane Princess charter provides that if
BG Group exercises its option to extend the charter beyond its initial term, the hire rate for the extension period or periods will be
reduced by approximately 28%.
Hire Rate
³+LUHUDWH´UHIHUVWRWKHEDVLFSD\PHQWIUom the customer for use of the vessel.
Golar Mazo. The hire rate is payable monthly in advance in U.S. Dollars as specified in the charter and includes three
JHQHUDOFRPSRQHQWVWKHRZQHU¶VFRVWFRPSRQHQWWKHRSHUDWLQJFRVW component and the additional coVWFRPSRQHQW7KHRZQHU¶VFost
component provides for ownership costs (including construction financing) and all remunerations due to owner under the charter. The
operating cost component provides for the annual operating costs of the vessel and is subject to annual adjustment based on actual
costs. The additional cost component is comprised of reimbursement for certain costs associated with certain modifications,
improvements, alterations or replacements that are required pursuant to the charter, requested by Pertamina, or that are estimated to
cost more than $2 million and related to any financing we obtain at the request of Pertamina. Pertamina also pays hire for the vessel
during scheduled drydockings up to a certain number of days in each three-year period, which number is intended to correspond to the
number of days that the Golar Mazo is expected to be off-hire for an ordinary, regularly scheduled drydocking.
Methane Princess. The hire rate is payable monthly, in advance in U.S. Dollars as specified in the charter. The hire rate
includes two components: a capital cost component and an operating cost component. The capital cost component relates to the cost
RIWKHYHVVHO¶VSXUFKDVHDQGLVVWUXFWXUHGto meet that cost and to provide a profit on the services we provide as well as a return on
invested capital. The operating cost component is intended to compensate us for operating the vessel and to cover related expenses.
The amount of the operating cost component
39
was established between the parties at the beginning of the charter and increases at a fixed percentage per annum to reflect inflation,
except for insurance, which is covered at cost. The hire rate for the Methane Princess does not include an additional cost component,
and, accordingly, additional costs related to modifications, improvements, alterations or replacements that are not covered by the
operating cost component will be allocated at the time such costs are incurred among us and BG Group pursuant to negotiations
between us and BG Group. As a result, we may be responsible for a portion of any such additional costs.
The hire rates for each of our LNG carriers may be reduced if the vessel does not perform to certain of its specifications or if
we are in breach of any of our representations and warranties in the charter. Historically, we have had no instances of hire rate
reductions.
Expenses
Under our LNG carrier charters, we are responsible for vessel operating expenses, which include crewing, repairs and
maintenance, insurance, stores, lube oils and communication expenses and the cost of providing all of these items and services. The
customer generally pays the voyage expenses, which include all expenses relating to particular voyages, including any bunker fuel
expenses, LNG boil-off, port fees, cargo loading and unloading expenses, canal tolls, agency fees and commissions. A majority of the
vessel operating expenses we incur with respect to our operation of the Golar Mazo are charged to Pertamina on a cost pass-through
basis, as described above.
Off-hire
:KHQWKHYHVVHOLV³RIIKLUH´²RUQRWDYDLODEOHIRUVHUYLFH²WKHFXVWRPHUJHnerally is not required to pay the hire rate and we
are responsible for all costs. Prolonged off-hire may lead to vessel substitution or termination of the time charter.
A vessel generally will be deemed off-hire if there is a specified time it is not available for the customHU¶VXVHGXHWRDPRQg
other things:
d operational deficiencies, drydocking for repairs, maintenance or inspection, equipment breakdowns, or delays due to
accidents, crewing strikes, certain vessel detentions or similar problems; or
d our failure to maintain the vessel in compliance with its specifications and contractual standards or to provide the
required crew.
The Golar Mazo will not be considered to be off-hire for scheduled drydockings for a certain number of days in each three-
year period, and therefore we will continue to receive the hire rate under the Golar Mazo charter during such period. The number of
days during which the Golar Mazo will not be considered to be off-hire is intended to correspond to the number of days that the Golar
Mazo is expected to be off-hire for an ordinary, regularly scheduled drydocking.
Vessels are drydocked at least once during a five-year class cycle for inspection of the underwater parts and for repairs
related to inspections.
Ship Management and Maintenance
Under the charters, we are responsible for the technical management of our LNG carriers, including engagement and
provision of qualified crews, maintaining the vessel, arranging supply of stores and equipment, periodic drydocking, cleaning and
painting and ensuring compliance with applicable regulations, including licensing and certification requirements. Golar Management
and certain other affiliates of Golar provide these management services to the vessels in our fleet through fleet management
agreements with our vessel owning subsidiaries. Golar Wilhelmsen, a jointly controlled company that is jointly owned by Golar and
Wilhelmsen Ship Management (Norway) AS, provides certain technical management services to our vessels through agreements with
Golar Management.
40
We are focused on operating and maintaining our LNG carriers to the highest safety and industry standards and at the same
time maximizing revenue from each vessel. It is our policy to have our crews perform planned maintenance on our vessels while
underway, to reduce time required for repairs during drydocking. This will reduce the overall off-hire period required for dockings
and repairs. Since we generally do not earn hire from a vessel while it is in drydock (except in the case of the Golar Mazo, whose
charter provides for an allowance for any regularly scheduled drydocking in a three-year period, provided that, subsequent to every
two drydockings, the parties will meet to determine the allowance period for each of the two subsequent drydockings), we believe that
the additional revenue earned from reduced off-hire periods outweighs the expense of the additional crewmembers or subcontractors.
Termination
Each charter party has certain termination rights which include, among other things, the automatic termination of the LNG
carrier charter upon loss of the vessel. Additionally, either party may elect to terminate the charter upon the occurrence of specified
defaults or requisition by any governmental authority. In addition, we are generally entitled to suspend performance (but with the
continuing accrual to our benefit of hire payments and default interest) and terminate the charter if the customer defaults in its
payment obligations. Under the Methane Princess charter, upon a default by us, the charterer is also entitled to require the charter to
be substituted by a bareboat charter between us and the charterers on terms specified in the charter. In addition, under the Methane
Princess charter, either party may also terminate the charter in the event of war in specified countries or in locations that would
significantly disrupt the free trade of the vessel. Under the Golar Mazo charter, upon a default by us, the charterer is also entitled to
take possession of the vessel and operate, maintain anGLQVXUHLWDWWKHFKDUWHUHU¶VVROHULVNDQGH[SHQVH
A termination of any of our LNG carrier charters could have a material adverse effect on our business, results of operations
and financial condition and could significantly reduce our ability to make distributions to our unitholders. However, in the event of a
contract termination of any of our LNG carrier charters, we believe, based on current market conditions, that we would likely be able
to re-charter any of our LNG vessels at rates not significantly dissimilar to the charter rates under our existing LNG carrier charters
without a significant impact to our net cash flow. We cannot however guarantee this outcome.
Classification, Inspection and Maintenance
(YHU\ODUJHFRPPHUFLDOVHDJRLQJYHVVHOPXVWEH³FODVVHG´E\a classification society. The classification society certifies
WKDWWKHYHVVHOLV³LQFODVV´VLJQLI\LQJthat the vessel has been built and maintained in accordance with the rules of the classification
society and complies with applicable rules and regulations of that particular class of vessel as laid down by that society and the
applicable flag state.
For maintenance of the class certificate, regular and extraordinary surveys of hull, machinery, including the electrical plant
and any special equipment classed, are required to be performed by the classification society, to ensure continuing compliance.
Vessels are drydocked at least once during a five-year class cycle for inspection of the underwater parts and for repairs related to
inspections. If any defects are found, the classification survH\RUZLOOLVVXHD³UHFRPPHQGDWLRQ´which must be rectified by the
shipowner within prescribed time limits. The classification society also undertakes on request of the flag state other surveys and
checks that are required by the regulations and requirements of that flag state. These surveys are subject to agreements made in each
individual case and/or to the regulations of the country concerned.
Most insurance underwriters make it a condition for insuraQFHFRYHUDJHWKDWDYHVVHOEHFHUWLILHGDV³LQFODVV´E\D
classification society, which is a member of the International Association of Classification Societies. The Golar Mazo is certified by
Lloyds Register, and the Methane Princess, the Golar Spirit, the Golar Freeze, and the Golar Winter are each certified by Det Norske
Veritas. All of our vessels have been awarded ISM certification and arHFXUUHQWO\³LQFODVV´
The ship manager carries out inspections of the ships on a regular basis; both at sea and while the vessels are in port, while
Golar carries out inspection and ship audits to verify conformity with the manaJHU¶VUHSRUWV7KHUHVXOWVRIWKHVHLQVSHFWLRQVZKLFK
are conducted both in port and while underway, result in a report containing recommendations for improvements to the overall
condition of the vessel, maintenance, safety and crew welfare. Based in part on these evaluations, we create and implement a program
of continual maintenance and improvement for our vessels and their systems.
Safety, Management of Ship Operations and Administration
Safety is our top operational priority. Our vessels are operated in a manner intended to protect the safety and health of our
employees, the general public and the environment. We actively manage the risks inherent in our
41
business and are committed to eliminating incidents that threaten safety, such as groundings, fires and collisions. We are also
committed to reducing emissions and waste generation. We have established key performance indicators to facilitate regular
monitoring of our operational performance. We set targets on an annual basis to drive continuous improvement, and we review
performance indicators monthly to determine if remedial action is necessary to reach our targets. GoODU¶VVKRUHVWDIISHUIRUPV a full
range of technical, commercial and business development services for us. This staff also provides administrative support to our
operations in finance, accounting and human resources.
Through its affiliates, Golar assists us in managing our ship operations and maintaining a technical department to monitor
and audit our ship manager operations. Our appointed ship manager, Golar Wilhelmsen Management AS (Golar Wilhelmsen), is
working to the standard of International Standards OrganizatioQ¶VRU,62DQG,62DQGKDYHWKURXJK'HW1RUVNH
Veritas, the Norwegian classification society, and Lloyds, obtained approval of their safety management systems as being in
compliance with the International Safety Management Code (or ISM Code), on behalf of the appropriate Flag State for the vessels in
our current fleet, which are flagged in the Marshall Islands, UK or Liberia. Golar Wilhelmsen, established in 2010, received its ISO
FHUWLILFDWLRQRQ$SULO2XUYHVVHOV¶VDIHW\PDQDJHment certificates are being maintained through ongoing internal audits
performed by the manager and intermediate audits performed by Det Norske Veritas or Lloyds. To supplement our operational
experience, Golar and its affiliates provide expertise in various functions critical to our operations. This affords an efficient and cost
effective operation and, pursuant to administrative services agreements with certain affiliates of Golar, access to human resources,
financial and other administrative functions. Critical ship management functions that will be provided by Golar Management through
various of its offices around the world include:
d technical management, maintenance, dockings;
d crew management;
d procurement, purchasing, forwarding logistics;
d marine operations;
d vetting, oil major and terminal approvals;
d shipyard supervision;
d insurance; and
d financial services.
These functions are supported by onboard and onshore systems for maintenance, inventory, purchasing and budget
PDQDJHPHQW,QDGGLWLRQ*RODU¶VGD\WRGD\IRFXVRQFRVWFRQWUROZLOOEHDSSOLHGWRRXURSHUDWLRQV7RVRPHH[WHQWWKHXQLIorm
design of some of our vessels and the adoption of common equipment standards should also result in operational efficiencies,
including with respect to crew training and vessel management, equipment operation and repair, and spare parts ordering.
Competition
We operate in markets that are highly competitive and based primarily on supply and demand. We compete for charters based
upon price, customer relationships, operating expertise, professional reputation and size, age and condition of the vessel.
Competition for providing FSRUs and LNG carriers for chartering purposes comes from a number of experienced shipping
companies. Some of our competitors have significantly greater financial resources than we do and can operate larger fleets and may be
able to offer better charter rates. An increasing number of marine transportation companies have entered the FSRU and LNG carrier
sector, including many with strong reputations and extensive resources and experience. This increased competition may cause greater
price competition for time charters. While the majority of the existing world LNG carrier fleet is employed on long-term charters,
there is
42
competition for the employment of vessels whose charters are expiring and for the employment of vessels which are not dedicated to a
long-term contract.
Competition for long-term LNG charters is based primarily on price, vessel availability, size, age and condition of the vessel,
relationships with LNG carrier users, the quality of LNG carrier users and the experience and reputation of the carrier operator. In
addition, vessels may operate in the emerging LNG carrier spot market that covers short-term charters of one year or less during
periods of increased competition due to an oversupply of LNG carriers.
Seasonality
Our vessels primarily operate under long-term charters and are not subject to the effect of seasonal variations in demand.
Crewing and Staff
As of December 31, 2011, Golar employed (directly and through ship managers) approximately 233 seagoing staff who serve
on our vessels. Golar and its affiliates may employ additional seagoing staff to assist us as we grow. Certain affiliates of Golar,
including Golar Management and Golar Wilhelmsen, provide commercial and technical management services, including all necessary
crew-related services, to our subsidiaries pursuant to the fleet management agreements3OHDVHUHDG³,WHP²0DMRU8QLWKROGHUVand
5HODWHG3DUW\7UDQVDFWLRQV²5HODWHG3DUW\7UDQVDFWLRQV²)OHHW0DQDJHPHQW$JUHHPHQWV´:HUHJDUGDWWUDFWLQJDQGUHWDLQLQJ
motivated seagoing personnel as a top priority. Like Golar, we offer our seafarers competitive employment packages and
opportunities for personal and career development, which relates to a philosophy of promoting internally. The officers operating our
vessels are engaged on individual employment contracts, while the ship managers have entered into Collective Bargaining
Agreements that cover substantially all of the seamen that operate the vessels in our current fleet, which are flagged in the Marshall
Islands, UK or Liberia. We believe our relationships with these labor unions are good. Our commitment to training is fundamental to
the development of the highest caliber of sHDIDUHUVIRURXUPDULQHRSHUDWLRQV*RODU¶Vcadet training approach is designed to balance
academic learning with hands-on training at sea. Golar has relationships with training institutions in Croatia, India, Norway,
Philippines, Indonesia and the United Kingdom. After receiving formal instruction at one of thHVHLQVWLWXWLRQVRXUFDGHWV¶WUaining
continues on board one of our vessels. We believe that high-quality crewing and training policies will play an increasingly important
role in distinguishing the preferred larger and LNG-experienced independent shipping companies from those that are newcomers to
LNG and lacking in-house experienced staff and established expertise on which to base their customer service and safety operations.
Risk of Loss, Insurance and Risk Management
The operation of any vessel, including FSRUs and LNG carriers, has inherent risks. These risks include, mechanical failure,
personal injury, collision, property loss, vessel or cargo loss or damage and business interruption due to political circumstances in
foreign countries or hostilities. In addition, there is always an inherent possibility of marine disaster, including explosion, spills and
other environmental mishaps, and the liabilities arising from owning and operating vessels in international trade. We believe that our
present insurance coverage is adequate to protect us against the accident related risks involved in the conduct of our business and that
we maintain appropriate levels of environmental damage and pollution insurance coverage consistent with standard industry practice.
However, not all risks can be insured, and there can be no guarantee that any specific claim will be paid, or that we will always be able
to obtain adequate insurance coverage at reasonable rates.
We have obtained hull and machinery insurance on all our vessels against marine and war risks, which include the risks of
damage to our vessels, salvage or towing costs, and also insure against actual or constructive total loss of any of our vessels.
However, our insurance policies contain deductible amounts for which we will be responsible. We have also arranged additional total
loss coverage for each vessel. This coverage, which is called hull interest and freight interest coverage, provides us additional
coverage in the event of the total loss of a vessel.
We have also obtained loss of hire insurance to protect us against loss of income in the event one of our vessels cannot be
employed due to damage that is covered under the terms of our hull and machinery insurance. Under our loss of hire policies, our
insurer will pay us the daily rate agreed in respect of each vessel for each day, in
43
excess of a certain number of deductible days, for the time that the vessel is out of service as a result of damage, for a maximum of
240 days. The number of deductible days varies from 14 days to 30 days, depending on the type of damage; machinery or hull
damage.
Protection and indemnity insurance, which covers our third party legal liabilities in connection with our shipping activities, is
provided by a mutual protection and indemnity association, or P&I club. This includes third party liability and other expenses related
to the injury or death of crew members, passengers and other third party persons, loss or damage to cargo, claims arising from
collisions with other vessels or from contact with jetties or wharves and other damage to other third party property, including pollution
arising from oil or other substances, and other related costs, including wreck removal. Subject to the capping discussed below, our
coverage, except for pollution, is unlimited.
Our current protection and indemnity insurance coverage for pollution is $1 billion per vessel or FSRU per incident. The
thirteen P&I clubs that comprise the International Group of Protection and Indemnity Clubs insure approximately 90% of the worlG¶V
commercial tonnage and have entered into a pooling agreement toUHLQVXUHHDFKDVVRFLDWLRQ¶VOLDELOLWLHV(DFK3 ,FOXEKDVFDSped its
exposure in this pooling agreement so that the maximum claim covered by the pool and its reinsurance would be approximately $5.45
billion per accident or occurrence. We are a member of Gard and Skuld P&I Clubs. As a member of these P&I clubs, we are subject
to a call for additional premiums based on thHFOXEV¶FODLPVUHFRUGDVZHOODVWKHFOaims record of all other members of the P&I clubs
comprising the International Group. However, our P&I clubs have reinsured the risk of additional premium calls to limit our
additional exposure. This reinsurance is subject to a cap, and there is the risk that the full amount of the additional call would not be
covered by this reinsurance.
The insurers providing the covers for Hull and Machinery, Hull and Cargo interests, Protection and Indemnity and Loss of
Hire insurances have confirmed that they will consider the FSRUs as vessels for the purpose of providing insurance. For the FSRUs,
ZHKDYHDOVRDUUDQJHGDQDGGLWLRQDO³([WHQGHG&RQWUDFWXDO/LDELOLW\´RIPLOOLRQLQUHODWLRQWRLQGHPQLILFDWLRQUHTXLUHGE\the
charter.
:HZLOOXVHLQRXURSHUDWLRQV*RODU¶VWKRURXJKULVNPDQDJHPHQW program that includes, among other things, computer-aided
risk analysis tools, maintenance and assessment programs, a seafarers competence training program, seafarers workshops and
membership in emergency response organizatLRQV:HH[SHFWWREHQHILWIURP*RODU¶VFRPPLWPHQWWRVDIHW\DQGHQYLURQPHQWDO
protection as certain of its subsidiaries assist us in managing our vessel operations. Golar Wilhelmsen, our ship manager, received its
ISO 9001 in April 2011, and is certified in accordance withWKH,02¶V,QWHUQDWLRQDO0DQDJHPHQW Code for the Safe Operation of
Ships and Pollution Prevention on a fully integrated basis.
Environmental and Other Regulation
General
Governmental and international agencies extensively regulate the carriage, handling, storage and regasification of LNG.
These regulations include international conventions and national, state and local laws and regulations in the countries where our
vessels now or, in the future, will operate or where our vessels are registered. We cannot predict the ultimate cost of complying with
these regulations, or the impact that these regulations will have on the resale value or useful lives of our vessels. Various
governmental and quasi governmental agencies require us to obtain permits, licenses and certificates for the operation of our vessels.
Although we believe that we are substantially in compliance with applicable environmental laws and regulations and have all
permits, licenses and certificates required for our vessels, future non-compliance or failure to maintain necessary permits or approvals
could require us to incur substantial costs or temporarily suspend operation of one or more of our vessels. A variety of governmental
and private entities inspect our vessels on both a scheduled and unscheduled basis. These entities, each of which may have unique
requirements and each of which conducts frequent inspections, include local port authorities, such as the U.S. Coast Guard, harbor
master or equivalent, classification societies, flag state, or the administration of the country of registry, charterers, terminal operators
and LNG producers. Our FSRUs are subject to inspections on an unscheduled basis and we expect, in the future, they will also be
subject to inspection by the applicable governmental and private entities on a scheduled basis.
44
Golar Wilhelmsen is operating in compliance with the International Standards Organization (or ISO) Environmental Standard
for the management of the significant environmental aspects associated with the ownership and operation of a fleet of LNG carriers.
Golar Wilhelmsen received its ISO 9001 certification (quality management systems) in April 2011 and is in the process of receiving
certification to the ISO 14001 Environmental Standard. This certification requires that we and Golar Wilhelmsen commit managerial
resources to act on our environmental policy through an effective management system.
International Maritime Regulations of LNG Vessels
7KH,02LVWKH8QLWHG1DWLRQV¶DJHQF\WKDWSURYLGHVLQWHUQDWLonal regulations governing shipping and international maritime
trade. The requirements contained in the International Management Code for the Safe Operation of Ships and for Pollution Prevention
(the ISM Code) promulgated by the IMO, govern our operations. Among other requirements, the ISM Code requires the party with
operational control of a vessel to develop an extensive safety management system that includes, among other things, the adoption of a
policy for safety and environmental protection policy setting forth instructions and procedures for operating its vessels safely and also
describing procedures for responding to emergencies. Golar Wilhelmsen, our ship manager, holds a Document of Compliance under
the ISM Code for operation of Gas Carriers that meets the standards set by the IMO.
Vessels that transport gas, including LNG carriers and FSRUs, are also subject to regulation under the International Gas
Carrier Code (or the IGC Code) published by the IMO. The IGC Code provides a standard for the safe carriage of LNG and certain
other liquid gases by prescribing the design and construction standards of vessels involved in such carriage. Compliance with the IGC
Code must be evidenced by a Certificate of Fitness for the Carriage of Liquefied Gases in Bulk. Each of our vessels is in compliance
with the IGC Code and each of our newbuilding/conversion contracts requires that the vessel receive certification that it is in
compliance with applicable regulations before it is delivered. Non-compliance with the IGC Code or other applicable IMO
regulations may subject a shipowner or a bareboat charterer to increased liability, may lead to decreases in available insurance
coverage for affected vessels and may result in the denial of access to, or detention in, some ports.
The IMO also promulgates ongoing amendments to the international convention for the Safety of Life at Sea 1974 and its
protocol of 1988, otherwise known as SOLAS. SOLAS provides rules for the construction of and equipment required for commercial
vessels and includes regulations for safe operation. It requires the provision of lifeboats and other life-saving appliances, requires the
use of the Global Maritime Distress and Safety System which is an international radio equipment and watchkeeping standard, afloat
and at shore stations, and relates to the Treaty on the Standards of Training and Certification of Watchkeeping Officers (or STCW)
also promulgated by the IMO. Flag states that have ratified SOLAS and STCW generally employ the classification societies, which
have incorporated SOLAS and STCW requirements into their class rules, to undertake surveys to confirm compliance.
SOLAS and other IMO regulations concerning safety, including those relating to treaties on training of shipboard personnel,
lifesaving appliances, radio equipment and the global maritime distress and safety system, are applicable to our operations. Non-
compliance with these types of IMO regulations may subject us to increased liability or penalties, may lead to decreases in available
insurance coverage for affected vessels and may result in the denial of access to or detention in some ports. For example, the U.S.
Coast Guard and European Union authorities have indicated that vessels not in compliance with the ISM Code are prohibited from
trading in U.S. and European Union ports.
In the wake of increased worldwide security concerns, the IMO amended SOLAS and added the International Ship and Port
Facility Security Code (or ISPS Code) as a new chapter to that convention. The objective of the ISPS, which came into effect on
July 1, 2004, is to detect security threats and take preventive measures against security incidents affecting ships or port facilities.
Golar Wilhelmsen has developed Security Plans, appointed and trained Ship and Office Security Officers and all of our vessels have
EHHQFHUWLILHGWRPHHWWKH,636&RGH6HH³²9HVVHO6HFXULW\5HJXODWLRQV´IRUDPRUHGHWDLOHGGLscussion about these requirements.
The IMO continues to review and introduce new regulations. It is impossible to predict what additional regulations, if any,
may be passed by the IMO and what effect, if any, such regulation may have on our operations.
45
Air Emissions
The International Convention for the Prevention of Marine Pollution from Ships (or MARPOL), is the principal international
convention negotiated by the IMO governing marine pollution prevention and response. MARPOL imposes environmental standards
on the shipping industry relating to oil spills, management of garbage, the handling and disposal of noxious liquids, sewage and air
HPLVVLRQV0$532/$QQH[9,³5HJXODWLRQVIRUWKHSUHYHQWLRQRI$LU3ROOXWLRQ´RU$QQH[9,HQWHUHGLQWRIRUFHRQ0D\
2005, and applies to all ships, fixed and floating drilling rigs and other floating platforms. Annex VI sets limits on sulfur oxide and
nitrogen oxide emissions from ship exhausts, emissions of volatile compounds from cargo tanks, incineration of specific substances,
and prohibits deliberate emissions of ozone depleting substances. Annex VI also includes a global cap on sulfur content of fuel oil
and allows for special areas to be established with more stringent controls on sulfur emissions. The certification requirements for
Annex VI depend on size of the vessel and time of periodical classification survey. Ships more than 400 gross tons and engaged in
international voyages involving countries that have ratified the conventions, or ships flying the flag of those countries, are required to
have an International Air Pollution Certificate (or an IAPP Certificate). Annex VI came into force in the United States on January 8,
2009. As of the current date, all our ships have IAPP Certificates.
In March 2006, the IMO amended Annex I to MARPOL, including a new regulation relating to oil fuel tank protection,
which became effective August 1, 2007. The new regulation applies to various ships delivered on or after August 1, 2010. It includes
requirements for the protected location of the fuel tanks, performance standards for accidental oil fuel outflow, a tank capacity limit
and certain other maintenance, inspection and engineering standards. IMO regulations also require owners and operators of vessels to
adopt Ship Oil Pollution Emergency Plans. Periodic training and drills for response personnel and for vessels and their crews are
required.
On July 1, 2010, amendments proposed by the United States, Norway and other IMO member states to Annex VI to the
MARPOL Convention took effect that require progressively stricter limitations on sulfur emissions from ships. In Emission Control
Areas (or ECAs), limitations on sulfur emissions require that fuels contain no more than 1% sulfur. Beginning on January 1, 2012,
fuel used to power ships may contain no more than 3.5% sulfur. This cap will then decrease progressively until it reaches 0.5% by
January 1, 2020. The amendments all establish new tiers of stringent nitrogen oxide emissions standards for new marine engines,
depending on their date of installation. The European directive 2005/33/EU, which is effective from January 1, 2010, bans the use of
fuel oils containing more than 0.1% sulfur by mass by any merchant vessel while at berth in any EU country. Our vessels have
achieved compliance, where necessary, by being modified to burn gas in their boilers when alongside. Low sulfur marine diesel oil
(or LSDO) has been purchased as the only fuel for the Diesel Generators. More specifically, the Methane Princess is trading world
wide by the charterer and on this vessel the boilers have been converted to burn LSDO. The FSRUs are arranged for burning of gas
only while in port, and have not had their boilers converted for burning of LSDO. The FSRUs (the Golar Winter, Golar Spirit, and
the Golar Freeze) are not likely to be traded to EU ports in the foreseeable future. The charterer of the Golar Mazo has selected not to
perform the boiler conversion to burn LSDO. Under the TCP for this vessel the charterer will have to cover the costs for the LSDO
conversion if he should choose to trade the vessel to an EU port. The Golar Mazo is engaged in carrying WKHFKDUWHUHU¶V/1*IURP
Indonesia to Taiwan.
Additionally, more stringent emission standards could apply in coastal areas designated as ECAs, such as the United States
and Canadian coastal areas designated by WKH,02¶V0DULQH(QYLURQPHQW3URWHFWLRQ&RPPLWWHHDVGLVFXVVHGLQ³²86&OHDQ$LU
$FW´EHORZ86DLUHPLVVLRQVVWDQGDUGVDUHQRZHTXLYDOHQWWR these amended Annex VI requirements, and once these amendments
become effective, we may incur costs to comply with these revised standards. Additional or new conventions, laws and regulations
may be adopted that could require the installation of expensive emission control systems. Because our vessels are largely powered by
means other than fuel oil we do not anticipate that any emission limits that may be promulgated will require us to incur any material
costs for the operation of our vessels but that possibility cannot be eliminated.
Ballast Water Management Convention
The IMO has negotiated international conventions that impose liability for oil pollution in international waters and the
territorial waters of the signatory to such conventions. For example, the IMO adopted an International Convention for the Control and
0DQDJHPHQWRI6KLSV¶%DOODVW:DWHUDQG6HGLPHQWVRUWKH%:0&RQYHQWLRQLQ)HEUXDU\7KH%:0&RQYHQWLRQ¶V
implementing regulations call for a phased introduction of
46
mandatory ballast water exchange requirements (beginning in 2009), to be replaced in time with a requirement for mandatory ballast
water treatment. The BWM Convention will not become effective until 12 months after it has been adopted by 30 states, the
combined merchant fleets of which represent not less than 35% of WKHJURVVWRQQDJHRIWKHZRUOG¶VPHUFKDQWVKLSSLQJ7KRXJKWKis
has not occurred to-date, the IMO has passed a resolution encouraging the ratification of the BWM Convention and calling upon those
countries that have already ratified to encourage the installation of ballast water management systems on new ships. As referenced
below, the United States Coast Guard issued new ballast water management rules on March 23, 2012. Under the requirements of the
BWM Convention for units with ballast water capacity more than 5000 cubic meters that were constructed in 2011 or before, ballast
water management exchange or treatment will be accepted until 2016. From 2016 (or not later than the first intermediate or renewal
survey after 2016), only ballast water treatment will be accepted by the BWM Convention. Installation of ballast water treatment
systems will be needed on the Golar Mazo and Methane Princess. As long as the FSRUs (the Golar Winter, Golar Spirit, and the
Golar Freeze) are operating as FSRUs and kept stationary they will not need installation of ballast water treatment systems. However,
XQGHUWKHLUWLPHFKDUWHUSDUW\³7&3´Golar Spirit and Golar Winter may be required to trade as LNG carriers. If the respective
vessel charterers should choose to trade the Golar Spirit or Golar Winter internationally as LNG carriers, the vessels will have to be
equipped with ballast water treatment systems and the cost of the related modifications will be split between the charterer and owner.
Given that ballast water treatment technologies are still at the developmental stage, at this time the additional costs of complying with
these rules are unclear, but current estimates suggest that additional costs are not likely to be material.
Bunkers Convention/CLC State Certificate
The International Convention on Civil Liability for Bunker Oil Pollution 2001 (or the Bunker Convention) entered into force
in State Parties to the Convention on November 21, 2008. The Bunker Convention provides a liability, compensation and compulsory
insurance system for the victims of oil pollution damage caused by spills of bunker oil. The Bunker Convention requires the ship
owner liable to pay compensation for pollution damage (including the cost of preventive measures) caused in the territory, including
the territorial sea of a State Party, as well as its economic zone or equivalent area. Registered owners of any sea going vessel and
seaborne craft over 1,000 gross tonnage, of any type whatsoever, and registered in a State Party, or entering or leaving a port in the
territory of a State Party, will be required to maintain insurance which meets the requirements of the Bunker Convention and to obtain
a certificate issued by a State Party attesting that such insurance is in force. The State issued certificate must be carried on board at all
times.
P&I Clubs in the International Group issue WKHUHTXLUHG%XQNHUV&RQYHQWLRQ³%OXH&DUGV´WRHQDEOHVLJQDWRU\VWDWHVWRLVVXH
certificates. All of our vessels have receiYHG³%OXH&DUGV´IURPWKHLU3 ,&OXEDQGare in possession of a CLC State-issued certificate
attesting that the required insurance coverage is in force.
The flag state, as defined by the United Nations Convention on Law of the Sea, has overall responsibility for the
LPSOHPHQWDWLRQDQGHQIRUFHPHQWRILQWHUQDWLRQDOPDULWLPHUHJXODWLRQVIRUDOOVKLSVJUDQWHGWKHULJKWWRIO\LWVIODJ7KH³6KLpping
Industry Guidelines on Flag StatH3HUIRUPDQFH´HYDOXDWHVIODJVWDWHVEDVHGRQIactors such as sufficiency of infrastructure, ratification
of international maritime treaties, implementation and enforcement of international maritime regulations, supervision of surveys,
casualty investigations and participation at the IMO meetings.
United States Environmental Regulation of LNG Vessels
Our vessels operating in U.S. waters now or, in the future, will be subject to various federal, state and local laws and
regulations relating to protection of the environment. In some cases, these laws and regulations require us to obtain governmental
permits and authorizations before we may conduct certain activities. These environmental laws and regulations may impose
substantial penalties for noncompliance and substantial liabilities for pollution. Failure to comply with these laws and regulations may
result in substantial civil and criminal fines and penalties. As with the industry generally, our operations will entail risks in these
areas, and compliance with these laws and regulations, which may be subject to frequent revisions and reinterpretation, increases our
overall cost of business.
47
Oil Pollution Act and CERCLA
OPA 90 established an extensive regulatory and liability regime for environmental protection and clean-up of oil spills. OPA
90 affects all owners and operators whose vessels trade with the United States or its territories or possessions, or whose vessels
operate in the waters of the United States, which include the U.S. territorial waters and the two hundred nautical mile exclusive
economic zone of the United States. CERCLA applies to the discharge of hazardous substances whether on land or at sea. While
OPA 90 and CERCLA would not apply to the discharge of LNG, they may affect us because we carry oil as fuel and lubricants for our
engines, and the discharge of these could cause an environmental hazard. Under OPA 90, vessel operators, including vessel owners,
PDQDJHUVDQGEDUHERDWRU³GHPLVH´FKDUWHUHUVDUH³UHVSRQVLEOHSDUWLHV´ZKRDUHDOOliable regardless of fault, individually and as a
group, for all containment and clean-up costs and other damages arising from oil spills from theiUYHVVHOV7KHVH³UHVSRQVLEOHSDUWLHV´
would not be liable if the spill results solely from the act or omission of a third party, an act of God or an act of war. The other
damages aside from clean-up and containment costs are defined broadly to include:
d natural resource damages and related assessment costs;
d real and personal property damages;
d net loss of taxes, royalties, rents, profits or earnings capacity;
d net cost of public services necessitated by a spill response, such as protection from fire, safety or health hazards; and
d loss of subsistence use of natural resources.
Effective July 31, 2009, the U.S. Coast Guard adjusted the limits of OPA liability to the greater of $2,000 per gross ton or
$17.088 million for any double-hull tanker that is over 3,000 gross tons (subject to possible adjustment for inflation) (relevant to ours
DQG*RODU¶V/1*FDUULHUV7KHVHOLPLWVRIOLDELOLW\GRQRWDSSOy, however, where the incident is caused by violation of applicable
U.S. federal safety, construction or operaWLQJUHJXODWLRQVRUE\WKHUHVSRQVLEOHSDUW\¶VJURVVQHJOLJHQFHRUZLOOIXOPLVFRQGXFt. These
limits likewise do not apply if the responsible party fails or refuses to report the incident or to cooperate and assist in connection with
the substance removal activities. This limit is subject to possible adjustment for inflation. OPA 90 specifically permits individual
states to impose their own liability regimes with regard to oil pollution incidents occurring within their boundaries, and some states
have enacted legislation providing for unlimited liability for discharge of pollutants within their waters. In some cases, states, which
KDYHHQDFWHGWKHLURZQOHJLVODWLRQKDYHQRW\HWLVVXHGLPSOHPHQWLQJUHJXODWLRQVGHILQLQJVKLSRZQHUV¶UHVSRQVLELOLWLHVXQGHUWKese
laws.
CERCLA, which also applies to owners and operators of vessels, contains a similar liability regime and provides for cleanup,
removal and natural resource damages for relHDVHVRI³KD]DUGRXVVXEVWDQFHV´/LDELOLW\under CERCLA is limited to the greater of
$300 per gross ton or $0.5 million for each release from vessels not carrying hazardous substances as cargo or residue, and $300 per
gross ton or $5 million for each release from vessels carrying hazardous substances as cargo or residue. As with OPA 90, these limits
of liability do not apply where the incident is caused by violation of applicable U.S. federal safety, construction or operating
UHJXODWLRQVRUE\WKHUHVSRQVLEOHSDUW\¶VJURVVQHJOLJHQFHRUZLllful misconduct or if the responsible party fails or refuses to report the
incident or to cooperate and assist in connection with the substance removal activities. OPA 90 and CERCLA each preserve the right
to recover damages under existing law, including maritime tort law. We believe that we are in substantial compliance with OPA 90,
CERCLA and all applicable state regulations in the ports where our vessels call.
OPA 90 requires owners and operators of vessels to establish and maintain with the U.S. Coast Guard evidence of financial
responsibility sufficient to meet the limit of their potential strict liability under OPA 90/CERCLA. Under the regulations, evidence of
financial responsibility may be demonstrated by insurance, surety bond, self-insurance or guaranty. Under OPA 90 regulations, an
owner or operator of more than one vessel is required to demonstrate evidence of financial responsibility for the entire fleet in an
amount equal only to the financial responsibility requirement of the vessel having the greatest maximum liability under OPA
90/CERCLA. We currently maintain U.S. Coast Guard National Pollution Funds Center issued three-year Certificates of Financial
Responsibility (or COFR), supported by guarantees which we purchased from an insurance based provider, for the
48
Methane Princess, the Golar Spirit, and the Golar Winter. The Golar Mazo has yet to call on a U.S. port and, therefore, does not
currently have a COFR. The Golar Freeze previously held a COFR but because it is currently stationed in Dubai as an FSRU with no
plans to call on a U.S. port, the COFR was not renewed. We believe that we will be able to continue to obtain the requisite guarantees
and that we will continue to be granted COFRs for each of our vessels that is required to have one.
In response to the BP Deepwater Horizon oil spill, the U.S. Congress is currently considering a number of bills that could
potentially increase or even eliminate the limits of liability under OPA 90. Compliance with any new requirements of OPA 90 may
substantially impact our cost of operations or require us to incur additional expenses to comply with any new regulatory initiatives or
statutes. Additional legislation or regulation applicable to the operation of our vessels that may be implemented in the future as a
result of the 2010 BP Deepwater Horizon oil spill in the Gulf of Mexico could adversely affect our business and ability to make
distributions to our unitholders.
Clean Water Act
The United States Clean Water Act (or CWA) prohibits the discharge of oil or hazardous substances in United States
navigable waters unless authorized by a permit or exemption, and imposes strict liability in the form of penalties for unauthorized
discharges. The CWA also imposes substantial liability for the costs of removal, remediation and damages and complements the
remedies available under OPA and CERCLA. The EPA has enacted rules governing the regulation of ballast water discharges and
other discharges incidental to the normal operation of vessels within U.S. waters. Under the new rules, which took effect February 6,
2009, commercial vessels 79 feet in length or longer (other than commercial fishing vessels), or Regulated Vessels, are required to
obtain a CWA permit regulating and authorizing such normal discharges. This permit, which the EPA has designated as the Vessel
General Permit for Discharges Incidental to the Normal Operation of Vessels (or VGP) incorporates the current U.S. Coast Guard
requirements for ballast water management as well as supplemental ballast water requirements, and includes limits applicable to 26
specific discharge streams, such as deck runoff, bilge water and gray water. For each discharge type, among other things, the VGP
establishes effluent limits pertaining to the constituents found in the effluent, including best management practices (or BMPs)
designed to decrease the amount of constituents entering the waste stream. Unlike land-based discharges, which are deemed
acceptable by meeting certain EPA-imposed numerical effluent limits, each of the 26 VGP discharge limits is deemed to be met when
a Regulated Vessel carries out the BMPs pertinent to that specific discharge stream. The VGP imposes additional requirements on
certain Regulated Vessel types that emit discharges unique to those vessels. Administrative provisions, such as inspection, monitoring,
recordkeeping and reporting requirements, are also included for all Regulated Vessels. Since 2009, several environmental groups and
industry associations filed challenges in U.S. federal court toWKH(3$¶VLVVXDQFHRIWKH9HVVHO General Permit. These cases brought by
industry associations were consolidated for hearing in the United States Court of Appeals for the District of Columbia Circuit. On
July 22, 2011, the United States Court of ASSHDOVIRUWKH'LVWULFWRI&ROXPELD&LUFXLWLVVXHGDQRUGHUGHQ\LQJSHWLWLRQHUV¶SHWition for
review of the VGP. Petitioners have the right to seek further DSSHOODWHUHYLHZRIWKHFRXUW¶VUXOLQJEXWWKHFRXUW¶VRUGHUSUHvents any
suspension of enforcement of the rules as written.
The National Invasive Species Act (or NISA) was enacted in 1996 in response to growing reports of harmful organisms being
released into U.S. ports through ballast water taken on by ships in foreign ports. NISA established a ballast water management
program for ships entering U.S. waters. Under NISA, mid-ocean ballast water exchange is voluntary, except for ships heading to the
Great Lakes, Hudson Bay, or vessels engaged in the foreign exportRI$ODVNDQ1RUWK6ORSHFUXGHRLO+RZHYHU1,6$¶VH[SRUWLQJDnd
record-keeping requirements are mandatory for vessels bound for any port in the United States. Although ballast water exchange is the
primary means of complianFHZLWKWKHDFW¶VJXLGHOLQHVFRPSOLDnce can also be achieved through the retention of ballast water
onboard the ship, or the use of environmentally sound alternative ballast water management methods approved by the U.S. Coast
Guard. If the mid-ocean ballast exchange is made mandatory throughout the United States, or if water treatment requirements or
options are instituted, the costs of compliance could increase for ocean carriers.
Several U.S. states have added specific requirements to the Vessel General Permit and, in some cases, may require vessels to
install ballast water treatment technology to meet biological performance standards. On March 8, 2011, EPA reached a settlement with
VHYHUDOHQYLURQPHQWDOJURXSVDQGWKH6WDWHRI0LFKLJDQUHJDUGLQJ(3$¶VLVVXDQFHRIWKe Vessel General Permit. As part of the
settlement, EPA agreed to include in the next draft Vessel General Permit numeric concentration-based effluent limits for discharges
of ballast water expressed as organisms
49
per unit of ballast water volume. These reTXLUHPHQWVFRUUHVSRQGZLWKWKH,02¶VDGRStion of similar requirements as discussed
above. EPA proposed a draft Vessel General Permit on November 30, 2011 which includes a numeric standard to control the release
of non-indigenous invasive species in ballast water discharges. The permit will be subject to a 75-day public comment period and the
final Vessel General Permit will be issued by November 30, 2012, which is a full year before the current permit is scheduled to expire.
Further on March 23, 2012, the U.S. Coast Guard issued a final rule establishing standards for the allowable concentration of
living organisms in ballast water discharged in U.S. waters and requiring the phase-in of Coast Guard approved ballast water
management systems (or BWMS). The rule goes into effect on June 20, 2012 and adopts ballast water discharge standards for vessels
calling on U.S. ports and intending to discharge ballast water eqXLYDOHQWWRWKRVHVHWLQ,02¶V%:0&RQYHQWLRQ7KHILQDO
rule requires that ballast water discharge have no more than 10 living organisms per milliliter for organisms between 10 and 50
micrometers in size. For organisms larger than 50 micrometers, the discharge can have 10 living organisms per cubic meter of
discharge. New ships constructed on or after December 1, 2012 must comply with these standards and some existing ships must
comply by their first dry dock after January 1, 2014. The Coast Guard will review the practicability of implementing a more stringent
ballast water discharge standard and publish the results no later than January 1, 2016. Under our existing charter agreements, the costs
associated with the installation of ballast water treatment systems for the Golar Mazo would be allocated to our charterer if required
exclusively by U.S. law. The costs associated with the installations for Methane Princess, Golar Freeze and, Golar Spirit and Golar
Winter, if needed, would be, at least in part, our responsibility. Compliance with these regulations will entail additional costs, but
current estimates suggest that additional costs are not likely to be material.
Clean Air Act
The U.S. Clean Air Act of 1970, as amended (or the CAA) requires the EPA to promulgate standards applicable to emissions
of volatile organic compounds and other air contaminants. Our vessels are subject to vapor control and recovery requirements for
certain cargoes when loading, unloading, ballasting, cleaning and conducting other operations in regulated port areas and emission
VWDQGDUGVIRUVRFDOOHG³&DWHJRU\´PDULQHdiesel engines operating in U.S. waters. The marine diesel engine emission standards are
currently limited to new engines beginning with the 2004 model year. On April 30, 2010, the EPA promulgated final emission
standards for Category 3 marine diesel engines equivalent to those adopted in the amendments to Annex VI to MARPOL. The
emission standards apply in two stages: near-term standards for newly-built engines apply from 2011, and long-term standards
requiring an 80% reduction in nitrogen dioxides (or NOx) will apply from 2016. Compliance with these standards may cause us to
incur costs to install control equipment on our vessels in the future.
Regulation of Greenhouse Gas Emissions
In February 2005, the Kyoto Protocol entered into force. Pursuant to the Kyoto Protocol, adopting countries are required to
implement national programs to reduce emissions of certain gases, generally referred to as greenhouse gases, which are suspected of
contributing to global warming. Currently, the emissions of greenhouse gases from international shipping are not subject to the Kyoto
Protocol. However, international negotiations are continuing with respect to a successor to the Kyoto Protocol, which sets emission
reduction targets through 2012, and restrictions on shipping emissions may be included in any new treaty. In December 2009, more
than 27 nations, including the United States and China, signed the Copenhagen Accord, which includes a non-binding commitment to
reduce greenhouse gas emissions. In addition, in December 2011, the Conference of the Parties to the United Nations Convention on
Climate Change adopted the Durban Platform which calls for a process to develop binding emissions limitations on both developed
and developing countries under the United Nations Framework Convention on Climate Change applicable to all Parties. The European
Union indicated that it intended to propose an expansion of the existing European Union emissions trading scheme to include
emissions of greenhouse gases from vessels, if such emissions were not regulated through the IMO (or the UNFCCC) by the end of
2011.
On July 15, 2011, the IMO approved mandatory measures to reduce emissions of greenhouse gases from international
shipping. The amendments to MARPOL Annex VI Regulations for the prevention of air pollution from ships add a new Chapter 4 to
Annex VI on Regulations on energy efficiency requiring the Energy Efficiency Design Index (EEDI), for new ships, and the Ship
Energy Efficiency Management Plan (SEEMP) for all ships. Other amendments to Annex VI add new definitions and requirements for
survey and certification, including the format for the International Energy Efficiency Certificate. The regulations apply to all ships of
400 gross tonnage and above
50
and are expected to enter into force on January 1, 2013. When these regulations enter into force, these new rules will likely affect the
operations of vessels that are registered in countries that are signatories to MARPOL Annex VI or vessels that call upon ports located
within such countries. The implementation of the EEDI and SEEMP standards could cause us to incur additional compliance costs.
The IMO is also considering the development of a market-based mechanism for greenhouse gas emissions from ships, but it is
impossible to predict the likelihood that such a standard might be adopted or its potential impact on our operations at this time.
In the United States, the EPA has issued a final finding that greenhouse gases threaten public health and safety, and has
promulgated regulations that regulate the emission of greenhouse gases. In 2009 and 2010, EPA adopted greenhouse reporting
requirements for various onshore facilities, and also adopted a rule in 2011 imposing control technology requirements on certain
stationary sources subject to the federal Clean Air Act. The EPA may decide in the future to regulate greenhouse gas emissions from
ships and has already been petitioned by the California Attorney General to regulate greenhouse gas emissions from ocean-going
vessels. Other federal and state regulations relating to the control of greenhouse gas emissions may follow, including climate change
initiatives that have been considered in the U.S. Congress. Any passage of climate control legislation or other regulatory initiatives by
the IMO, the European Union, the United States, or other countries where we operate, or any treaty adopted at the international level
to succeed the Kyoto Protocol, that restrict emissions of greenhouse gases could require us to make significant financial expenditures
that we cannot predict with certainty at this time. In addition, even without such regulation, our business may be indirectly affected to
the extent that climate change results in sea level changes or more intense weather events.
Dubai Environmental Regulations
The Golar Freeze is now in Dubai waters and is subject to various regulations relating to protection of the environment.
These laws and regulations require us to obtain governmental permits and authorizations before we may conduct certain activities.
DUSUP, our charter party, has the contractual responsibility to obtain all permits necessary to operate the Golar Freeze in Dubai, and
it already has done so. However, it is still our responsibility to meet the requirements of the environmental laws. To the extent that
WKHORFDOHQYLURQPHQWDOODZVDQGUHJXODWLRQVRI'XEDLEHFRPHPRUHVWULQJHQWRYHUWLPHLWLV'8683¶VREOLJDWLRQWRIXQGWKHFRVts of
improvements needed to meet any such requirements.
)RULQVWDQFH'XEDL¶V)HGHUDO/DZ1RRIIRUWKH3Uotection and Development of the Environment requires major
projects to be licensed by the Federal Environmental Agency. As part of the licensure application, the Agency requires an
environmental impact assessment to determine WKHSURMHFW¶VHIIHFWRQWKHenvironment. Vessels are prohibited from discharging
KDUPIXOVXEVWDQFHVLQFOXGLQJRLOLQWR'XEDL¶VZDWHUV. Violators are subject to fines. At this time, Golar Freeze constitutes a major
project under the applicable regulations and we supplied the necessary information to DUSUP. Using the information provided,
DUSUP has acquired all of the necessary operating permits to complyZLWK'XEDL¶V)HGHUDO/DZ1R
,QDGGLWLRQ'XEDL¶V/DZ1RRIRQOLFHQVLQJ0DULQH7UDQVSRUW0HDQVLQFOXGHVOLFHQVLQJDQGUHJLVWUDWLRQ
requirements for vessels and crews. As a condition of licensing, registration, or license renewal, the vessel owner must present
evidence of an insurance policy issued by an insurance company which is licensed to operate in Dubai and which covers the owner
against liability from damages inflicted upon third parties. VesseOVHQWHULQJ'XEDL¶VZDWHUVDUHUHTXLUHGWREHLQFRPSOLDQFHwith the
technical specifications of their flag state and the Dubai Maritime City Authority (or DMCA) is authorized to conduct technical
LQVSHFWLRQVRIYHVVHOVHQWHULQJ'XEDL¶VZDWHUV7KH'0&$LVDXthorized to create additional environmental regulations and in the
future the DMCA may create regulations which effect greenhouse gas emissions. Violators of Law No. 11 of 2010 can be subject to
fines, cancellation of licensure, and seizure of the vessel. We have obtained the requisite insurance and have met the applicable
licensure and registration requirements for the Golar Freeze.
Also, the DMCA has issued two regulations which both took effect on August 1, 2011. The Dubai Anchorages Regulation
DSSOLHVWRYHVVHOVHQWHULQJ'XEDL¶VZDWHUVDQGH[FOXVLYHHFRQRPLF]RQH7KHRZQHURIDYHVVHOPXVWLQGHPQLI\WKH'0&$IRUDOO
claims and costs arising out of actual or potential pollution damage and costs of cleanup resulting from any act, omissions, neglect or
default of the Master of the vessel, employees, contractors or sub-contractors or from the unseaworthiness of the vessel. The Ship to
Ship Transfer Operations Regulation requires vessels to carry a Ship to Ship Transfer Operation Plan conforming to the requirements
RI0$532/$QQH[,7KH2SHUDWLRQ3ODQPXVWEHDSSURYHGE\WKHYHVVHO¶VIODJDGPLQLVWUDWLRQRUVXEPLWWHG
51
electronically to the DMCA for review. After April 1, 2012, all Operation Plans must be aSSURYHGE\WKHYHVVHO¶VIODJ
administration. Violators of these regulations are subject to criminal liability.
These environmental laws and regulations and others may impose costly and onerous obligations and violation or pollution
events can lead to substantial civil and criminal fines and penalties. Because the cost of improvements needed to comply with any
such new laws or regulations of Dubai is generally the responsibility of DUSUP, we do not foresee any increases in our overall cost of
business due to any revisions or reinterpretations of existing Dubai law, or the promulgation of new Dubai or UAE environmental
regulations.
Vessel Security Regulations
Since the terrorist attacks of September 11, 2001, there have been a variety of initiatives intended to enhance vessel security.
On November 25, 2002, the Maritime Transportation Act of 2002 (or MTSA) came into effect. To implement certain portions of the
MTSA, in July 2003, the U.S. Coast Guard issued regulations requiring the implementation of certain security requirements aboard
vessels operating in waters subject to the jurisdiction of the United States. Similarly, in December 2002, amendments to SOLAS
created a new chapter of the convention dealing specifically with maritime security. The new chapter became effective in July 2004
and imposes various detailed security obligations on vessels and port authorities, most of which are contained in the ISPS Code. The
ISPS Code is designed to protect ports and international shipping against terrorism. After July 1, 2004, to trade internationally, a
vessel must attain an International Ship Security Certificate (or ISSC) from a recognized security organization approved by the
YHVVHO¶VIODJVWDWH
Among the various requirements are:
d on-board installation of automatic identification systems to provide a means for the automatic transmission of safety-
related information from among similarly equipped ships and VKRUHVWDWLRQVLQFOXGLQJLQIRUPDWLRQRQDVKLS¶VLGHQWLW\
position, course, speed and navigational status;
d on-board installation of ship security alert systems, which do not sound on the vessel but only alerts the authorities on
shore;
d the development of vessel security plans;
d VKLSLGHQWLILFDWLRQQXPEHUWREHSHUPDQHQWO\PDUNHGRQDYHVVHO¶VKXOO
d DFRQWLQXRXVV\QRSVLVUHFRUGNHSWRQERDUGVKRZLQJDYHVVHO¶VKLVWRU\LQFOXGLQJWKHQDPHRIWKHVKLSDQGRIWKHVWDWH
whose flag the ship is entitled to fly, the date on which the ship was registered with that stDWHWKHVKLS¶V identification
number, the port at which the ship is registered and the name of the registered owner(s) and their registered address; and
d compliance with flag state security certification requirements.
The U.S. Coast Guard regulations, intended to align with international maritime security standards, exempt non-U.S. vessels
from obtaining U.S. Coast Guard-approved MTSA vessel security plans provided such vessels have on board an ISSC that attests to
WKHYHVVHO¶VFRPSOLDQFHZLWK62/$6VHFXULty requirements and the ISPS Code.
Our vessel managers have developed Security Plans, appointed and trained Ship and Office Security Officers and each of our
vessels in our fleet complies with the requirements of the ISPS Code, SOLAS and the MTSA.
Other Regulation
Our LNG vessels may also become subject to the 2010 HNS Convention, if it is entered into force. The Convention creates a
regime of liability and compensation for damage from hazardous and noxious substances (or HNS), including liquefied gases. The
2010 HNS Convention sets up a two-tier system of compensation composed of compulsory insurance taken out by shipowners and an
HNS Fund which comes into play when the insurance is
52
insufficient to satisfy a claim or does not cover the incident. Under the 2010 HNS Convention, if damage is caused by bulk HNS,
claims for compensation will first be sought from the shipowner up to a maximum of 100 million Special Drawing Rights (or SDR).
If the damage is caused by packaged HNS or by both bulk and packaged HNS, the maximum liability is 115 million SDR. Once the
limit is reached, compensation will be paid from the HNS Fund up to a maximum of 250 million SDR. The 2010 HNS Convention
has not been ratified by a sufficient number of countries to enter into force, and we cannot estimate the costs that may be needed to
comply with any such requirements that may be adopted with any certainty at this time.
Inspection by Classification Societies
(YHU\ODUJHFRPPHUFLDOVHDJRLQJYHVVHOPXVWEH³FODVVHG´by a classification society. A classification society certifies that a
YHVVHOLV³LQFODVV´VLJQLI\LQJWKDWWKHYHssel has been built and maintained in accordance wLWKWKHUXOHVRIWKHYHVVHO¶VFRXntry of
registry and the international conventions of which that country is a member. In addition, where surveys are required by international
conventions and corresponding laws and ordinances of a flag state, the classification society will undertake them on application or by
official order, acting on behalf of the authorities concerned.
2XU)658VDUH³FODVVHG´DVYHVVHOVDQGKDYHREWDLQHGWKe additional class notation REGAS-2 signifying that the
regasification installations are designed aQGDSSURYHGIRUFRQWLQXRXVRSHUDWLRQ7KHUHIHUHQFHWR³YHVVHOV´LQWKHIROORZLQJalso
apply to our FSRUs. For maintenance of the class certificate, regular and special surveys of hull, machinery, including the electrical
plant and any special equipment classed, are required to be performed by the classification society, to ensure continuing compliance.
Vessels are drydocked at least once during a five-year class cycle for inspection of the underwater parts and for repairs related to
inspections. If any defects are found, the classification surveyRUZLOOLVVXHD³FRQGLWLRQRIFODVV´ZKLFKPXVWEHUHFWLILHGEy the
shipowner within prescribed time limits. The classification society also undertakes on request of the flag state other surveys and
checks that are required by the regulations and requirements of that flag state. These surveys are subject to agreements made in each
individual case and/or to the regulations of the country concerned.
Most insurance underwriters make it a condition for insuraQFHFRYHUDJHWKDWDYHVVHOEHFHUWLILHGDV³LQFODVV´E\D
classification society, which is a member of the International Association of Classification Societies. The Golar Mazo is certified by
Lloyds Register, and the Methane Princess, the Golar Spirit, the Golar Freeze, and the Golar Winter are each certified by Det Norske
Veritas. All of our vessels have been awarded ISM certification and arHFXUUHQWO\³LQFODVV´
In-House Inspections
Golar Wilhelmsen, our ship manager, carries out inspections of the ships on a regular basis; both at sea and when the vessels
are in port, while we carry out inspection and ship audits to veULI\FRQIRUPLW\ZLWKPDQDJHU¶VUHSRUWV7KHUHVXOWVRIWKHVH
inspections, which are conducted both in port and underway, result in a report containing recommendations for improvements to the
overall condition of the vessel, maintenance, safety and crew welfare. Based in part on these evaluations, we create and implement a
program of continual maintenance for our vessels and their systems.
Taxation of the Partnership
United States Taxation
The following is a discussion of the material U.S. federal income tax considerations applicable to us. This discussion is
based upon provisions of the Code as in effect on the date of this Annual Report, existing final and temporary regulations thereunder
(or Treasury Regulations), and current administrative rulings and court decisions, all of which are subject to change, possibly with
retroactive effect. Changes in these authorities may cause the tax consequences to vary substantially from the consequences described
below. The following discussion is for general information purposes only and does not purport to be a comprehensive description of
all of the U.S. federal income tax considerations applicable to us.
Election to be Treated as a Corporation. We have elected to be treated as a corporation for U.S. federal income tax
purposes. As such, we are subject to U.S. federal income tax on our income to the extent it is from U.S.
53
sources or is otherwise effectively connected with the conduct of a trade or business in the Unites States as discussed below.
Taxation of Operating Income. Substantially all of our gross income is attributable to the transportation, regasification and
storage of LNG, and we expect that substantially all of our gross income will continue to be attributable to the transportation,
regasification and storage of LNG. Gross income generated from regasification and storage of LNG outside of the United States
generally is not subject to U.S. federal income tax, and gross income generated from such activities in the United States generally is
subject to U.S. federal income tax. Gross income that is attributable to transportation that either begins or ends, but that does not both
begin and end, in the United States (or U.S. Source International Transportation Income) is considered to be 50.0% derived from
sources within the United States and may be subject to U.S. federal income tax as described below. Gross income attributable to
transportation that both begins and ends in the United States (or U.S. Source Domestic Transportation Income) is considered to be
100.0% derived from sources within the United States and generally is subject to U.S. federal income tax. Gross income attributable
to transportation exclusively between non-U.S. destinations is considered to be 100.0% derived from sources outside the United States
and generally is not subject to U.S. federal income tax.
We are not permitted by law to engage in transportation that gives rise to U.S. Source Domestic Transportation Income, and
we do not anticipate providing any regasification or storage services within the territorial seas of the United States. However, certain
of our activities give rise to U.S. Source International Transportation Income, and future expansion of our operations could result in an
increase in the amount of U.S. Source International Transportation Income, all of which could be subject to U.S. federal income
taxation unless the exemption from U.S. taxation under Section 883 of the Code (or the Section 883 Exemption) applies.
The Section 883 Exemption. In general, the Section 883 Exemption provides that if a non-U.S. corporation satisfies the
requirements of Section 883 of the Code and the Treasury Regulations thereunder (or the Section 883 Regulations), it will not be
subject to the net basis and branch taxes or the 4.0% gross basis tax described below on its U.S. Source International Transportation
Income. The Section 883 Exemption applies only to U.S. Source International Transportation Income and does not apply to U.S.
Source Domestic Transportation Income. As discussed below, we believe that based on our current ownership structure, the
Section 883 Exemption applies and we are not subject to U.S. federal income tax on our U.S. Source International Transportation
Income.
To qualify for the Section 883 Exemption, we must, among other things, meet the following three requirements:
d be organized in a jurisdiction outside the United States that grants an equivalent exemption from tax to corporations
organized in the United States with respect to the types of U.S. Source International Transportation Income that we earn
(or an Equivalent Exemption);
d satisfy the Publicly Traded Test (as described below) or the Qualified Shareholder Stock Ownership Test (as described
below); and
d meet certain substantiation, reporting and other requirements.
In order for a non-U.S. corporation to meet the Publicly TradHG7HVWLWVHTXLW\LQWHUHVWVPXVWEH³SULPDULO\WUDGHG´DQG
³UHJXODUO\WUDGHG´RQDQHVWDEOLVKHGVHFXULWLes market either in the United States or in a jurisdiction outside the United States that
grants an Equivalent Exemption. The Section 883 Regulations provide, in pertinent part, that equity interests in a non-U.S.
FRUSRUDWLRQZLOOEHFRQVLGHUHGWREH³SULPDULO\WUDGHG´RQDQestablished securities market in a given country if, with respect to the
class or classes of equity relied upon to PHHWWKH³UHJXODUO\WUDGHG´requirement described below, the number of units of each such
class that are traded during any taxable year on all established securities markets in that country exceeds the number of units in such
class that are traded during that year on established securities markets in any other single country. Equity interests in a non-U.S
corporation will be considered WREH³UHJXODUO\WUDGHG´RQDQHVWDEOLVKHGVHFXUities market under the Section 883 Regulations if one or
more classes of such equity interests that, in the aggregate, represent more than 50.0% of the combined vote and value of all
outstanding equity interests in the non-U.S. corporation satisfy certain listing and trading volume requirements. These listing and
trading volume requirements will be satisfied with respect to a class of equity interests if trades in such class are effected, other than in
de minimis quantities, on an established securities
54
market on at least 60 days during the taxable year and the aggregate number of units in such class that are traded on an established
securities market during the taxable year is at least 10.0% of the average number of units outstanding in that class during the taxable
year (with special rules for short taxable years). In addition, a class of equity interests will be considered to satisfy these listing and
trading volume requirement if the equity interests in such class are traded during the taxable year on an established securities market
LQWKH8QLWHG6WDWHVDQGDUH³UHJularly quoted by dealers making DPDUNHW´LQVXFKFODVVZLWKLQthe meaning of the Section 883
Regulations).
Even if a class of equity satisfies the foregoing requirements, and thus generally wRXOGEHWUHDWHGDV³UHJXODUO\WUDGHG´RQDQ
established securities market, an exception may apply to cause the class to fail the regularly traded test if, for more than half of the
number of days during the taxable year, one or more 5.0% unitholders (i.e., unitholders owning, actually or constructively, at least
5.0% of the vote and value of that class) own in the aggregate 50.0% or more of the vote and value of the class (or the Closely Held
Block Exception). The Closely Held Block Exception does not apply, however, in the event the corporation can establish that a
sufficient proportion of such 5.0% unitholders are Qualified Shareholders (as defined below) so as to preclude other persons who are
5.0% unitholders from owning 50.0% or more of the value of that class for more than half the days during the taxable year.
As set forth above, as an alternative to satisfying the Publicly Traded Test, a non-U.S. corporation may qualify for the
Section 883 Exemption by satisfying the Qualified Shareholder Stock Ownership Test. A corporation generally will satisfy the
Qualified Shareholder Stock Ownership Test if more than 50.0% of the value of its outstanding equity interests is owned, or treated as
owned after applying certain attribution rules, for at least half of the number of days in the taxable year by:
d individual residents of jurisdictions that grant an Equivalent Exemption;
d non-U.S. corporations organized in jurisdictions that grant an Equivalent Exemption and that meet the Publicly Traded
Test; or
d certain other qualified persons described in the Section 883 Regulations (which we refer to collectively as Qualified
Shareholders).
We believe that we satisfy all of the requirements for the Section 883 Exemption, and we expect that we will continue to
satisfy such requirements. We are organized under the laws of the Republic of the Marshall Islands. The U.S. Treasury Department
has recognized the Republic of the Marshall Islands as a jurisdiction that grants an Equivalent Exemption. Consequently, our U.S.
Source International Transportation Income (including for this purpose, any such income earned by our subsidiaries) is and will be
exempt from U.S. federal income taxation provided we meet either the Publicly Traded Test or the Qualified Shareholder Stock
Ownership Test and we satisfy certain substantiation, reporting and other requirements.
Because our common units are traded only on The Nasdaq Global Market, which is considered to be an established securities
market, our equity interests are ³SULPDULO\WUDGHG´RQDQHVWDEOLVhed securities market for purposes of the Publicly Traded Test.
Although the matter is not free from doubt, based on our current and expected cash flow and distributions on our outstanding equity
interests, we believe that our common units represent more than 50.0% of the total value of all of our outstanding equity interests, and
we believe that we currently satisfy, and will continue to satisfy, the listing and trading volume requirements described previously. In
addition, our partnership agreement provides that any person or group that beneficially owns more than 4.9% of any class of our units
then outstanding generally will be treated as owning only 4.9% of such units for purposes of voting for directors. Although there can
be no assurance that this limitation will be effective to eliminate the possibility that we have or will have any 5.0% unitholders for
purposes of the Closely Held Block Exception, based on the current ownership of our common units, we believe that our common
units have not lost eligibility for the Section 883 Exemption as a result of the Closely Held Block Exception. Thus, although the
matter is not free from doubt and is based upon our belief and expectations regarding our satisfaction of the factual requirements
described above we believe that we will satisfy the Publicly Traded Test for the present taxable year and future taxable years.
The conclusions described above are based upon legal authorities that do not expressly contemplate an organizational
structure such as ours. In particular, although we have elected to be treated as a corporation for U.S. federal income tax purposes, we
are organized as a limited partnership under Marshall Islands law. Accordingly,
55
while we believe that, assuming satisfaction of the factual requirements described above, our coPPRQXQLWVDUHFRQVLGHUHG³UHJXlarly
WUDGHG´RQDQHVWDEOLVKHGVHFXULWLes market and that we should satisfy the requirements for the Section 883 Exemption, it is possible
that the IRS would assert that our common units do not meet the ³UHJXODUO\WUDGHG´WHVW,QDGGLWLRQDVGHVFULEHGSUHYLRXVO\ our
ability to satisfy the Publicly Traded Test depends upon factual matters that are subject to change. Should any of the factual
requirements described above fail to be satisfied, we may not be able to satisfy the Publicly Traded Test. Furthermore, our board of
directors could determine that it is in our best interests to take an action that would result in our not being able to satisfy the Publicly
Traded Test in the future.
In the event we are not able to satisfy the Publicly Traded Test for a taxable year, we may be able to satisfy the Qualified
Shareholder Stock Ownership Test for that year provided Golar owns more than 50.0% of the value of our outstanding equity interests
for more than half of the days in such year, Golar itself met the Publicly Traded Test for such year and Golar provided us with certain
information that we need in order to claim the benefits of the Qualified Shareholder Stock Ownership Test. Golar has represented that
it presently meets the Publicly Traded Test and has agreed to provide the information described above. However, there can be no
assurance that Golar will continue to meet the Publicly Traded Test or be able to provide the information we need to claim the benefits
of the Section 883 Exemption under the Qualified Shareholder Ownership Test. Further, the relative values of our equity interests are
uncertain and subject to change, and as a result Golar may not own more than 50.0% of the value of our outstanding equity interests
for any future year. Consequently, there can be no assurance that we would meet the Qualified Shareholder Stock Ownership Test
based upon the ownership by Golar of an indirect ownership interest in us.
The Net Basis Tax and Branch Profits Tax. If we earn U.S. Source International Transportation Income and the Section 883
Exemption does not apply, the U.S. source portion of such income may be treated as effectively connected with the conduct of a trade
or business in the United States (or Effectively Connected Income) if we have a fixed place of business in the United States involved
in the earning of U.S. Source International Transportation Income and substantially all of our U.S. Source International Transportation
Income is attributable to regularly scheduled transportation or, in the case of vessel leasing income, is attributable to a fixed place of
business in the United States. In addition, if we earn income from regasification or storage of LNG within the territorial seas of the
United States, such income may be treated as Effectively Connected Income. Based on our current operations, substantially all of our
potential U.S. Source International Transportation Income is not attributable to regularly scheduled transportation or is received from
vessel leasing, and none of our regasification or storage activities occur within the territorial seas of the United States. As a result, we
do not anticipate that any of our U.S. Source International Transportation Income or income earned from regasification or storage will
be treated as Effectively Connected Income. However, there is no assurance that we will not earn income pursuant to regularly
scheduled transportation or bareboat charters attributable to a fixed place of business in the United States (or earn income from
regasification or storage activities within the territorial seas of the United States) in the future, which would result in such income
being treated as Effectively Connected Income.
Any income we earn that is treated as Effectively Connected Income, net of applicable deductions, would be subject to U.S.
federal corporate income tax (currently imposed at rates of up to 35.0%). In addition, a 30.0% branch profits tax could be imposed on
any income we earn that is treated as Effectively Connected Income, as determined after allowance for certain adjustments, and on
certain interest paid or deemed paid by us in connection with the conduct of our U.S. trade or business.
On the sale of a vessel that has produced Effectively Connected Income, we could be subject to the net basis U.S. federal
corporate income tax as well as branch profits tax with respect to the gain recognized up to the amount of certain prior deductions for
depreciation that reduced Effectively Connected Income. Otherwise, we would not be subject to U.S. federal income tax with respect
to gain realized on the sale of a vessel, provided the sale is considered to occur outside of the United States under U.S. federal income
tax principles. In general, a sale of vessel will be considered to occur outside of the United States for this purpose if title to the vessel,
and risk of loss with respect to the vessel, pass to the buyer outside the United States. It is expected that any sale of a vessel by us will
be considered to occur outside of the United States.
The 4.0% Gross Basis Tax. If the Section 883 Exemption does not apply and the net basis tax does not apply, we would be
subject to a 4.0% U.S. federal income tax on the U.S. source portion of our gross U.S. Source International Transportation Income,
without benefit of deductions. Under the sourcing rules described above under
56
³²8QLWHG6WDWHV7D[DWLRQ²7D[DWLRQRI2SHUDWLQJ,QFRPH´RIRXU866RXUFH,QWHUQDWLRQDO7UDQVSRUWDWLRQ,QFRPHZRXOGEH
treated as being derived from U.S. sources.
Marshall Islands Taxation
We believe that because we, our operating subsidiary and our controlled affiliates do not, and do not expect to conduct
business or operations in the Republic of the Marshall Islands, neither we nor our controlled affiliates will be subject to income,
capital gains, profits or other taxation under current Marshall Islands law. As a result, distributions by our operating subsidiary and
our controlled affiliates to us will not be subject to Marshall Islands taxation.
United Kingdom Taxation
The following is a discussion of the material United Kingdom tax consequences applicable to us. This discussion is based
upon existing legislation and current H.M. Revenue & Customs practice as of the date of this Annual Report. Changes in these
authorities may cause the tax consequences to vary substantially from the consequences described below. The following discussion is
for general information purposes only and does not purport to be a comprehensive description of all of the United Kingdom tax
considerations applicable to us.
Tax Residence and Taxation of a Permanent Establishment in the United Kingdom. A company treated as resident in the
United Kingdom for purposes of the United Kingdom Corporation Tax Acts is subject to corporation tax in the same manner and to
the same extent as a United Kingdom incorporated company. For this purpose, place of residence is determined by the place at which
central management and control of the company is carried out.
In addition, a non-United Kingdom resident company will be subject to United Kingdom corporation tax on profits
attributable to a permanent establishment in the United Kingdom to the extent it carries on a trade in the United Kingdom through
such a permanent establishment. A company not resident in the United Kingdom will be treated as having a permanent establishment
in the United Kingdom if it has a fixed place of business in the United Kingdom through which the business of the company is wholly
or partly carried on or if an agent acting on behalf of the company has and habitually exercises authority to enter into contracts on
behalf of the company.
Unlike a company, a partnership resident in the United Kingdom or carrying on a trade in the United Kingdom is not itself
subject to tax, although its partners generally will be liable for United Kingdom tax based upon their shares of the partnershiS¶V
LQFRPHDQGJDLQV3OHDVHUHDG³,WHP²,QIRUPDWLRQDERXWWKH3DUWQHUVKLS²7D[DWLRQRIWKH3DUWQHUVKLS²1RQ8QLWHG6WDWHV7D[
&RQVLGHUDWLRQV²8QLWHG.LQJGRP7D[&RQVHTXHQFHV´
Taxation of Non-United Kingdom Incorporated Subsidiaries. We will undertake measures designed to ensure that our non-
United Kingdom incorporated subsidiaries will be considered controlled and managed outside of the United Kingdom and not as
having a permanent establishment or otherwise carrying on a trade in the United Kingdom. While certain of our subsidiaries that are
incorporated outside of the United Kingdom will enter into agreements with Golar Management, a United Kingdom incorporated
company, for the provision of administrative and/or technical management services, we believe that the terms of these agreements will
not result in any of our non-United Kingdom incorporated subsidiaries being treated as having a permanent establishment or carrying
on a trade in the United Kingdom. As a consequence, we expect that our non-United Kingdom incorporated subsidiaries will not be
treated as resident in the United Kingdom and the profits these subsidiaries earn will not be subject to tax in the United Kingdom.
Taxation of United Kingdom Incorporated Subsidiaries. Each of our subsidiaries that is incorporated in the United Kingdom
will be regarded for the purposes of the United Kingdom Corporation Tax Acts as being resident in the United Kingdom and will be
liable to United Kingdom corporation tax on its worldwide income and chargeable gains, regardless of whether this income or gains
are remitted to the United Kingdom. The generally applicable rate of United Kingdom corporation tax is 26.0% (reducing to 24.0%
from April 1, 2012). Our United Kingdom incorporated subsidiaries will be liable to tax at this rate on their net income, profits and
gains after deducting expenses incurred wholly and exclusively for the purposes of the business being undertaken. There is currently
no United Kingdom withholding taxes on distributions made to us.
57
Brazilian Taxation
The following discussion is based upon our knowledge and understanding of the tax laws of Brazil and regulations, rulings
and judicial decisions thereunder, all as in effect of the date of this Annual Report and subject to possible change on a retroactive
basis. The following discussion is for general information purposes and does not purport to be a comprehensive description of all the
Brazilian income tax considerations applicable to us.
One of our subsidiaries, Golar 6HUYLoRVGH2SHUDomRGH(PEDUFDo}HV/WGDRUGolar Brazil), has entered into operation and
services agreements with Petrobras with respect to the Golar Spirit and the Golar Winter.
On commencement of trade by Golar Brazil in Brazil, which occurred in July 2008 upon delivery of the Golar Spirit, we
became subject to tax in Brazil (including net income taxes due from Golar Brazil, if any, and any Brazilian withholding taxes
required to be withheld by Golar Brazil from payments it makes to our other subsidiaries) in the approximate amount of 37.5% of the
payments due to Golar Brazil under the operation and services agreement with respect to the Golar Spirit and the Golar Winter. A
portion of this tax is withheld by Petrobras from payments it makes to Golar Brazil under the operation and services agreement, and
the remainder is collected directly from Golar Brazil.
Petrobras generally will not be required to withhold tax from payments it makes under the charters for the Golar Spirit or the
Golar WinterVRORQJDVWKHSD\PHQWVDUHQRWPDGHWRD³QRQWD[SD\LQJ´MXULVGLFWLRQDVGHILQHGE\WKH%UD]LOLDQDXWKRULWLHV
Payments by Petrobras under the charters will be made to UK resident companies and will not therefore be subject to withholding tax.
Brazil may levy tax on the importation of goods and assets into Brazil. However, under the agreements with Petrobras,
Petrobras is responsible for these taxes so as long as we provide the proper documentation and take the necessary measures in order to
clear the vessel and spare parts for importation and customs clearance. Consequently, we do not expect to be liable for any taxes on
the importation of goods or assets into Brazil.
Employees
Other than our Secretary, we currently do not have any employees and rely on the executive officers, directors and other key
employees of Golar Management who perform services for us pursuant to the management and administrative services agreement.
Golar Management also provides commercial and technical management services to our fleet and will provide administrative services
to us pursuant to the management and administrative services agrHHPHQW3OHDVHUHDG³,WHP'Lrectors, Senior Management and
(PSOR\HHV²([HFXWLYH2IILFHUV´
C. Organizational Structure
Golar GP LLC, a Marshall Islands limited liability company, is our general partner. Our general partner is a subsidiary of
Golar, which is a Bermuda exempted company. Please read Exhibit 8.1 to this Annual Report for a list of our significant subsidiaries
as of December 31, 2011.
D. Property, Plants and Equipment
Other than the vessels in our current fleet, we do not have any material property.
Item 4A. Unresolved Staff Comments
There are no written comments which have been provided by the staff of the Securities and Exchange Commission regarding
our periodic reports which remain unresolved as of the date of the filing of this Form 20-F with the Commission.
Item 5. Operating and Financial Review and Prospects
The following discussion of our financial condition and results of operations should be read in conjunction with our
historical financial statements and related notes included elsewhere in this Annual Report. Among other things, those financial
statements include more detailed information regarding the basis of presentation for the
58
following information. Our consolidated and combined financial statements have been prepared in accordance with U.S. GAAP and
are presented in U.S. Dollars.
The following discussion assumes that our business was operated as a separate entity prior to our IPO on April 13, 2011.
RHIHUHQFHVLQWKLV$QQXDO5HSRUWWRRXU³LQLWLDOIOHHW´UHIHUWRWKH*RODU:LQWHUWKe Golar Spirit, the Golar Mazo and the Methane
Princess, all of which were contributed to us at or prior to our IPO. The entities that own the vessels in our initial fleet have been
acquired in transactions deemed to be a reorganization of entities under common control and have, therefore, been recorded at GRODU¶s
book values. The historical financial statements for periods prior to the completion of our initial public offering on April 13, 2011,
which results are discussed below, have been carved out of the consolidated financial statements of Golar, which operated the vessels
in our initial fleet for periods prior to our IPO.
In October 2011, we acquired 100% interests in subsidiaries which owned and operated the FSRU, Golar Freeze from Golar.
This transaction was also deemed to be a reorganization of entities under common control. Accordingly, our financial statements prior
to the date this vessel was acquired by us were retroactively adjusted to include the results of the Golar Freeze. The periods
retroactively adjusted include all periods that we and the Golar Freeze were both under common control of Golar.
Our financial position, results of operations and cash flows reflected in our consolidated and combined financial statements
include all expenses allocable to our business, but may not be indicative of those that would have been achieved had we operated as a
separate public entity for all periods presented or of future results.
Background and Overview
We were formed by Golar in 2007, a leading independent owner and operator of LNG carriers and FSRUs, to own and operate
FSRUs and LNG carriers under long-term charters that generate long-term stable cash flows. Our fleet currently consists of three
FSRUs and two LNG carriers. We also have the right to purchase an additional vessel from Golar, the Nusantara Regas Satu (formerly
named the Khannur), following the completion of its FSRU retrofitting and acceptance by its charterer, which is expected to occur in
2012. We expect to make additional accretive acquisitions of FSRUs and LNG carriers with long-term charters from Golar and third
parties in the future as market conditions permit.
On April 13, 2011, we completed our IPO. In connection with our IPO, we issued to Golar 23,127,254 common units and
15,949,831 subordinated units. Our general partner also received 797,492 general partner units, representing a 2.0% general partner
LQWHUHVWLQXVDQGRIRXULQFHQWLYHGLVWULEXWLRQULJKWV³,'5V´:HLVVXHGWKHUHPDLQLQJ19% of our IDRs to Golar Energy, which
was acquired by Golar subsequent to the offering. In the IPO of our common units, Golar sold 13,800,000 common units to the public
at a price of $22.50 per common unit.
In October 2011, we acquired from Golar, 100% interests in certain subsidiaries which own and operate the FSRU, the Golar
Freeze and which hold the related secured bank debt. The acquisition of the Golar Freeze for $330 million from Golar was funded by
the assumption of bank debt of $108 million and $222 million of vendor financing provided by Golar, please read Note 20- Debt in the
notes to our consolidated and combined financial statements.
Our Charters
We generate revenues by chartering FSRU vessels and LNG carriers to customers for a fixed period of time at rates that are
generally fixed but may contain a variable component, such as an inflation adjustment.
As of March 31, 2012, the average remaining term of our existing long-term time charters is approximately nine years for our
FSRU vessels, subject to certain termination and purchase rights, and nine years for our LNG carriers.
Generally, under our existing charters, the rate we charge for our services, which we call WKH³KLUHUDWH´LQFOXGHVWKHIROORZing
two cost components:
59
d Capital Component. The capital component relates to the cost of the vessel¶VSXUFKDVHDQGLVVWUXFWXUHGWRPHHWWKDWFRVW
and to provide a profit on the services we provide and the risks we take, as well as a return on invested capital. The
capital component of our time charters is usually fixed; however, the Golar Spirit and Golar Winter charters provide for
inflation adjustments to the capital component.
d Operating Component. The operating component is intended to compensate us for vessel operating expenses, including
management fees. This component is established at the beginning of the charter and then typically either escalates
annually at a fixed percentage or fluctuates annually based on changes in a specified consumer price index.
Hire payments may be reduced if a vessel does not perform to certain of its technical specifications, such as if the average
vessel speed falls below a guaranteed speed or the amount of fuel consumed to power the vessel under normal circumstances exceeds a
guaranteed amount or if there is a reduction in the output of the regasification unit. Historically, we have had few instances of hire rate
reductions and none that have had a material impact on our operating results.
:KHQWKHYHVVHOLV³RIIKLUH´²RUQRWDYDLODEOHIRUVHUYLFH²WKHFXVWRPHUJHQHUDOO\LVQRt required to pay the hire rate and we
are responsible for all costs. Prolonged off-hire may lead to vessel substitution or termination of the time charter. A vessel generally
will be deemed off-hire if there is a loss of time due to, among other things:
d operational deficiencies; drydocking for repairs, maintenance or inspection; equipment breakdowns; special surveys;
vessel upgrades; or delays due to accidents, crewing strikes, certain vessel detentions or similar problems; or
d our failure to maintain the vessel in compliance with its specifications and contractual standards or to provide the required
crew.
For more information on our charters, SOHDVHUHDG³,WHP²,QIRUPDWLRQRQWKH3DUWQHUVKLS²)658&KDUWHUV´DQG³²/1*
&DUULHU&KDUWHUV´
Market Overview and Trends
Historically charter hire rates for LNG carriers have been uncertain and volatile as has the supply and demand for LNG
carriers. Since 2004, there has been an oversupply of LNG ships, however, this oversupply has been falling since the second half of
2010 and the trend has reversed, such that the demand for LNG shipping is currently not being met as a result of the lack of availability
of ships. This is primarily due to the lack of newbuilding orders placed during the years 2008 to 2010, partly as a result of the economic
downturn. As a result, the increase in demand for, and supply of, LNG is not being met by new shipping tonnage, and has led to strong
demand for LNG ships resulting in higher than average charter rates.
Please see the section entitled Item ³,QIRUPDWLRQRQWKH3DUWQHUVKLS´
Factors Affecting the Comparability of Future Results
Our historical results of operations and cash flows are not indicative of results of operations and cash flows to be expected in
the future, principally for the following reasons:
d Our financial results reflect the results of the FSRU, the Golar Freeze, acquired from Golar for all periods the vessel
was under common control. In October 2011, we acquired 100% interests in subsidiaries which own and operate the
Golar Freeze from Golar. This transaction was deemed to be a business acquisition between entities under common
control. Accordingly, we have accounted for this transaction in a manner similar to the pooling of interest method
whereby our financial statements prior to the date this vessel was acquired by us are retroactively adjusted to include the
results of the Golar Freeze. The periods retroactively adjusted include all periods that we and the acquired vessel were
both under common control of Golar. As a result, our financial statements reflect this vessel and
60
its results of operations referred to herein as the Dropdown Predecessor as if we had acquired it when the vessel began
operations under the ownership of Golar.
d The Golar Winter and the Golar Freeze did not generate revenues during the period of their retrofitting and are being
operated in a substantially different manner than they have in the past. The Golar Winter entered the shipyard for
retrofitting for FSRU service in September 2008. The Golar Winter completed its FSRU retrofitting and was redelivered
from the shipyard in May 2009 and commenced FSRU service under its long term charter with Petrobras in September
2009.
The Golar Freeze entered the shipyard in June 2009 to undergo retrofitting for FSRU service which was completed in
May 2010. In May 2010, the Golar Freeze commenced FSRU service under its long-term charter with DUSUP.
The Golar Winter and the Golar Freeze did not earn revenues while undergoing retrofitting in the shipyard.
d We intend to increase the size of our fleet by making other acquisitions. Our growth strategy focuses on expanding our
fleet through the acquisition of FSRUs and LNG carriers under long-term time charters. For example, in October 2011,
we acquired the Golar Freeze, an FSRU that was retrofitted from an LNG carrier, from Golar. We intend to exercise our
option to purchase the Nusantara Regas Satu from Golar subsequent to the completion of its FSRU retrofitting and
acceptance by its charterer, which is expected to occur in 2012, if we are able to reach an agreement with Golar regarding
its purchase price. We may need to issue additional equity or incur additional indebtedness to fund the acquisition of the
Nusantara Regas Satu and any additional vessels that we purchase.
d FSRU operating expenses are higher than the operating expenses for LNG carriers and increase our exposure to
foreign exchange rates. Our historical operating expenses reflect the operation of the Golar Spirit, the Golar Freeze and
the Golar Winter as LNG carriers until the commencement of their FSRU retrofitting in July 2008, June 2009 and
September 2009, respectively. Following the completion of their retrofitting to FSRUs, we incurred generally higher
operating expenses on the vessels as compared to when we operated these vessels as conventional LNG carriers. Under
the Petrobras charters, we incur a portion of our expenses and receive a portion of our revenues in Brazilian Reais and,
therefore, we have increased exposure to foreign exchange rates.
d We expect continued inflationary pressure on crew costs. Due to the specialized nature of operating FSRUs and LNG
carriers, the increase in size of the worldwide LNG carrier fleet and the limited pool of qualified officers, we believe that
crewing and labor related costs will experience significant increases.
d Our historical results of operations reflect allocated administrative costs that may not be indicative of future
administrative costs. The administrative costs included in our historical results of operations have been determined by
DOORFDWLQJ*RODU¶VDGPLQLVWUDWLYHFRVWVWRXVEDVHGRQWKHVL]HRIRXUIOHHWLQUHODWLRQWRWKHVL]HRI*RODU¶VIOHHW7KHVH
allocated costs may not be indicative of our future administrative costs. Under the management and administrative
services agreement that we have entered into with Golar Management, Golar Management provides significant
administrative, financial and other support services to us. We reimburse Golar Management for costs and expenses
incurred in connection with the provision of the services under that agreement. In addition, we pay Golar Management a
management fee equal to 5% of its costs and expenses incurred in connection with providing services to us.
d We are incurring additional general and administrative expenses as a publicly traded partnership. Since our IPO in
April 2011, we have begun to incur additional general and administrative expenses as a consequence of being a publicly
traded partnership, including costs associated with annual reports to unitholders, SEC filings, investor relations, registrar
and transfer agent fees, audit fees, incremental director and officer liability insurance costs anGGLUHFWRUV¶FRPSHQVDWLRQ
61
d We may enter into different financing arrangements. Our financing arrangements currently in place may not be
representative of the arrangements we will enter into in the future. For example, we may amend our existing credit
facilities or enter into new financing arrangements. For descriptions of our current financing arrangements, please read
³²/LTXLGLW\DQG&DSLWDO5HVRXUFHV²%RUURZLQJ$FWLYLWLHV´
d Our results are affected by fluctuations in the fair value of our derivative instruments. The change in fair value of our
derivative instruments is included in our net income (loss) as our derivative instruments are not designated as hedges for
accounting purposes. These changes may fluctuate significantly as interest rates IOXFWXDWH3OHDVHUHDG1RWH²
Financial Instruments in the notes to our consolidated and combined financial statements. The unrealized gains or losses
relating to the change in fair value of our derivatives do not impact our cash flows.
Factors Affecting Our Results of Operations
We believe the principal factors that will affect our future results of operations include:
d the number of vessels in our fleet, including our ability to acquire additional vessels from Golar or from third parties;
d our ability to maintain good relationships with our four existing customers and our future customers and to increase the
number of our customer relationships;
d increased demand for LNG shipping services, including floating storage and regasification services;
d our ability to successfully employ our vessels at economically attractive rates, as our charters expire or are otherwise
terminated;
d the effective and efficient technical management of our vessels;
d *RODU¶VDELOLW\WRREWDLQDQGPDLQWDLQPDMRULQWHUQDWLRQDOHQHUJ\FRmpany approvals and to satisfy their technical, health,
safety and compliance standards; and
d economic, regulatory, political and governmental conditions that affect the shipping and the LNG industry. This includes
changes in the number of new LNG importing countries and regions and availability of surplus LNG from projects around
the world, as well as structural LNG market changes allowing greater flexibility and enhanced competition with other
energy sources.
In addition to the factors discussed above, we believe certain specific factors have impacted, and will continue to impact, our
combined results of operations. These factors include:
d the hire rate earned by our vessels, unscheduled off-hire days and the level of our vessel operating expenses;
d mark-to-market charges in interest rate swaps and foreign currency derivatives;
d foreign currency exchange gains and losses;
d our access to capital required to acquire additional vessels and/or to implement our business strategy;
d increased crewing costs;
d our level of debt and the related interest expense and amortization of principal; and
d the level of any distribution on our common units.
62
3OHDVHUHDG³,WHP².H\,QIRUPDWLRQ²5LVN)DFWRUV´IRUDGLVFXVVLRQRIFHUWDLQULVNVLQKHUHQWLQRXUEXVLQHVV
Important Financial and Operational Terms and Concepts
We use a variety of financial and operational terms and concepts when analyzing our performance. These include the
following:
Total Operating Revenues. Total operating revenues refers to time charter revenues. We recognize revenues from time
charters over the term of the charter as the applicable vessel operates under the charter. We do not recognize revenue during days when
the vessel is off-hire, unless the charter agreement makes a specific exception.
Off-hire (Including Commercial Waiting Time). Our vessels may be out of service, that is, off-hire, for several reasons:
scheduled drydocking, special survey, vessel upgrade or maintenance or inspection, which we refer to as scheduled off-hire; days spent
waiting for a charter, which we refer to as commercial waiting time; and unscheduled repairs, maintenance, operational deficiencies,
equipment breakdown, accidents, crewing strikes, certain vessel detentions or similar problems, or our failure to maintain the vessel in
compliance with its specifications and contractual standards or to provide the required crew, which we refer to as unscheduled off-hire.
Voyage Expenses. Voyage expenses, which are primarily fuel costs but which also include other costs such as port charges,
are paid by our customers under our time charters. However, we may incur voyage related expenses during off-hire periods when
positioning or repositioning vessels before or after the period of a time charter or before or after drydocking, which expenses will be
payable by us. We also incur some voyage expenses, principally fuel costs, when our vessels are in periods of commercial waiting
time.
Time Charter Equivalent Earnings. In order to compare vessels trading under different types of charters, it is standard
industry practice to measure the revenue performance of a vessel in terms of average daily TCE. For our time charters, this is
calculated by dividing time charter revenues by the number of calendar days minus days for scheduled off-hire. Where we are paid a
fee to position or reposition a vessel before or after a time charter, this additional revenue, less voyage expenses, is included in the
calculation of TCE. For shipping companies utilizing voyage charters (where the vessel owner pays voyage costs instead of the
charterer), TCE is calculated by dividing voyage revenues, net of vessel voyage costs, by the number of calendar days minus days for
scheduled off-hire. TCE is a non-GAAP finaQFLDOPHDVXUH3OHDVHUHDG³,WHP².H\,QIRUPDWLRQ²6HOHFWHG+LVWRULFDO)LQDQFLDODQd
2SHUDWLQJ'DWD²1RQ*$$3)LQDQFLDO0HDVXUHV´IRUDUHFRQFLOLDWLRQRI7&(WRWRWDORSHUDWLQJUHYHQXHV7&(¶VPRVWGLUHFWO\
comparable financial measure in accordance with GAAP).
Vessel Operating Expenses. Vessel operating expenses include direct vessel operating costs associated with operating a
vessel, such as crew wages, which are the most significant component, vessel supplies, routine repairs, maintenance, lubricating oils,
insurance and management fees for the provision of commercial and technical management services.
Depreciation and Amortization. Depreciation and amortization expense, or the periodic cost charged to our income for the
reduction in usefulness and long-term value of our ships, is related to the number of vessels we own or operate under long-term capital
leases. We depreciate the cost of our owned vessels, less their estimated residual value, and amortize the amount of our capital lease
assets over their estimated economic useful lives, on a straight-line basis. We amortize our deferred drydocking costs over two to five
\HDUVEDVHGRQHDFKYHVVHO¶VQH[WDQWLFLSDWHGGU\GRFNLQJ,QFRPHGHULYHGIURPVDOHDQGVXEVHTXHQWO\OHDVHGDVVHWVLVGHIHUUHGand
amortized in proportion to the amortization of the leased assets.
Administrative Expenses. Administrative expenses are composed of general overhead, including personnel costs, legal and
professional fees, property costs and other general administration expenses. For the historical periods presented, certain administrative
H[SHQVHVLQFOXGLQJ*RODU¶VVWRFNEDVHGFRPSHQVDWLRQKDYHEHHQ principally carved out from the administrative expenses of Golar on
WKHEDVLVRI*RODU¶VQXPEHURIYHVVHOV$GPLQLVWUDWLYHH[SHQVHValso include a small amount of direct costs such as professional fees.
63
Interest Expense and Interest Income. Interest expense depends on our overall level of borrowing and may significantly
increase when we acquire or lease ships. While an LNG carrier is undergoing retrofitting into a FSRU, interest expense incurred is
capitalized on the cost of the vessel. Interest expense may also change with prevailing interest rates, although interest rate swaps or
other derivative instruments may reduce the effect of these changes. Interest income will depend on prevailing interest rates and the
level of our cash deposits and restricted cash deposits.
Impairment of Long-Lived Assets. Our vessels are reviewed for impairment whenever events or changes in circumstances
indicate that the carrying amount may not be recoverable. In assessing the recoverability of RXUYHVVHOV¶FDUU\LQJDPRXQWVZH must
make assumptions regarding estimated future cash flows and estimates in respect of residual or scrap value. We estimate those future
cash flows based on the existing service potential of our vessels. As of December 31, 2011, we did not perform an impairment test as
no trigger events have been identified. However, in the event there were triggering events identified, we follow a traditional present
value approach, whereby a single set of future cash flows is estimated. If the carrying value of a vessel were to exceed the
undiscounted future cash flows, we would write the vessel down to its fair value, which is calculated by using a risk-adjusted rate of
interest. Since our inception, our vessels have not been impaired.
However, for the years ended 2011, 2010 and 2009 impairment charges of $nil, $1.5 million and $1.5 million, respectively,
were recognized in respect of parts ordered for the FSRU conversion project that were not required for the conversion of the Golar
Spirit. Some of these parts have been used by Golar for other FSRU projects but these parts were not transferred to us by Golar.
Other Financial Items. Other financial items include financing fee arrangement costs, amortization of deferred financing
costs, market valuation adjustments for interest rate swap derivatives, foreign exchange gains/losses and foreign currency derivatives.
The market valuation adjustment for our interest rate and foreign currency derivatives may have a significant impact on our results of
operations and financial position although it does not impact our liquidity. Foreign exchange gains or losses arise due to the
retranslation of our capital lease obligations and the cash deposits securing those obligations. Any gain or loss represents an unrealized
gain or loss and will arise over time as a result of exchange rate movements. Our liquidity position will only be affected to the extent
that we choose or are required to withdraw monies from or pay additional monies into the deposits securing our capital lease
obligations.
Customers
In the years ended December 31, 2011, 2010 and 2009, revenues from the following customers accounted for over 10% of our
revenues:
Charterer
Petrobras
DUSUP
Pertamina
BG Group
Vessels
2011
Year Ended December 31,
2010
2009
(dollars in thousands, except percentages)
Golar Spirit and Golar
Winter
Golar Freeze
Golar Mazo
Methane Princess and
Golar Freeze
$
93,741
47,054
37,829
25,101
46% $
23%
19%
90,651
29,894
36,944
50% $
16%
20%
57,622
²
37,570
12%
25,051
14%
31,442
46%
²
30%
24%
Inflation and Cost Increases
Although inflation has had a moderate impact on operating expenses, interest costs, drydocking expenses and overhead, we do
not expect inflation to have a significant impact on direct costs in the current and foreseeable economic environment other than
potentially in relation to insurance costs and crew costs. It is anticipated that insurance costs, which have risen considerably over the
last three years, will continue to rise over the next few years. LNG transportation is a specialized area and the number of vessels is
increasing. Therefore, there has been an increased demand for qualified crew, which has and will continue to put inflationary pressure
on crew costs. Only vessels on full cost pass through charters would be fully protected from crew cost increases. The impact of these
increases will be mitigated to some extent by the following provisions in our existing charters:
64
d The Golar Mazo¶VFKDUWHUSURYLGHVIRURSHUDWLQJFRVWDQGLQVXUDQFHFRVWSDss-throughs, and so we will be protected from
the impact of the vast majority of such increases.
d The Methane Princess¶FKDUWHUSURYLGHVWKDWWKHRSHUDting cost component of the charter hire rate, established at the
beginning of the charter, will increase by a fixed percentage per annum, except for insurance, which is covered at cost.
d Under the OSAs for both the Golar Spirit and the Golar Winter, the charter hire rates are payable in Brazilian Reais. The
charter hire rates payable under the OSAs covers all vessel operating expenses, other than drydocking and insurance. The
charter hire rates payable under the OSAs were established between the parties at the time the charter was entered into and
will be increased based on a specified mix of consumer price and U.S. Dollar foreign exchange rate indices on an annual
basis.
d The Golar Freeze time charter provides for annual adjustments to the operating expense component of the charter hire rate
as necessary to take into account cost increases.
A. Operating Results
Year Ended December 31, 2011 Compared with the Year Ended December 31, 2010
Year Ended December 31,
2010
2011
Change
% Change
(dollars in thousands, except TCE and average daily vessel operating costs)
$
$
$
Total operating revenues
Voyage expenses
Vessel operating expenses
Administrative expenses
Depreciation and amortization
Impairment of long-term assets
Interest income
Interest expense
Other financial items
Taxes
Net income
Non-controlling interest
203,725
238
33,069
5,203
35,634
²
1,547
(19,880)
(20,115)
(1,609)
89,524
(9,863)
182,540
1,950
32,505
5,591
33,068
1,500
3,388
(17,952)
(20,629)
(1,122)
71,611
(9,250)
21,185
(1,712)
564
(388)
2,566
(1,500)
(1,841)
(1,928)
514
(487)
17,913
(613)
12%
(88)%
2%
(7)%
8%
(100)%
(54)%
11%
(2)%
43%
25%
7%
TCE (to the closest $100)
Average daily vessel operating costs
111,500
18,120
106,900
17,811
4,600
309
4%
2%
Operating days: During the year ended December 31, 2011, our total operatings days have increased to 1,818 days compared
to 1,690 days in 2010 as a result of the re-delivery of the Golar Freeze in May 2010 pursuant to completion of its FSRU retrofitting.
Operating Revenues: Operating revenues increased by $21.2 million to $203.7 million for the year ended December 31,
2011, compared to $182.5 million in 2010, primarily as a result of:
d $17.1 million of additional revenue as a result of a full year of operation of the Golar Freeze in 2011, as compared to
approximately eight months in 2010. The Golar Freeze was delivered under its 10 year time charter to DUSUP and was on-hire
commencing May 16, 2010 following its FSRU retrofitting; and
65
d $3.0 million of additional revenue due to increased hire rates under the Petrobras chDUWHUVLQDFFRUGDQFHZLWKWKHFKDUWHUHU¶V bi-
annual review to reflect inflation increases) with respect to our FSRUs, the Golar Winter and the Golar Spirit, effective from
April 2011.
2011
2010
Change
% Change
Calendar days less scheduled off-hire days
1,825
1,690
Average daily TCE (to the closest $100)
$
111,500 $
106,900 $
135
4,600
8%
4%
The increase of $4,600 in average daily time charter equivalent rates, or TCEs, for the year ended December 31, 2011 to
$111,500, compared to $106,900 in 2010, is primarily due to the Golar Freeze earning a full year of revenue in 2011 and the increase in
KLUHUDWHVXQGHUWKH3HWUREUDV¶ charters as described above.
Voyage Expenses: Voyage expenses primarily relate to fuel costs associated with commercial waiting time, vessel positioning
costs and charter-hire expenses. Voyage expenses decreased by $1.7 million to $0.2 million for the year ended December 31, 2011,
compared to $1.9 million in 2010. The decrease was principally due to the Golar Freeze incurring positioning costs from the shipyard
to the delivery destination at our cost, following the completion of its FSRU retrofitting in May 2010.
Vessel Operating Expenses: Vessel operating expenses increased by $0.6 million to $33.1 million for the year ended
December 31, 2011, compared to $32.5 million for the same period in 2010 primarily as a result of:
d Higher crew costs in 2011 due primarily (i) to the appreciation of the Brazilian Reais and Euro against the U.S. Dollar and (ii)
higher training costs incurred on our FSRUs operating in Brazil, the Golar Winter and the Golar Spirit; and
d An increase in vessel operating expenses of approximately $0.5 million relating to the operations of the Golar Freeze which
was due primarily to the Golar Freeze operating for a full year as a FSRU compared to only eight months in 2010. However,
this was partially offset by the effects of recruiting crew in anticipation of the commissioning process in May 2010 and to
commence FSRU training.
Accordingly, average daily vessel costs for the year ended December 31, 2011 was $18,120 compared to $17,811 in 2010.
Administrative Expenses: Administrative expenses decreased by $0.4 million to $5.2 million for the year ended December
31, 2011 and compared to $5.6 million for the year ended December 31, 2010.
Included within these expenses for the years ended December 31, 2011 and 2010 is $2.1 million and $4.9 million, respectively,
representing expenses that were carved out from the administrative expenses of Golar (including an allocation for stock-based
compensation costs) and a portion allocated to us based on the size of our fleet. The decrease in carved out administrative expenses of
$2.8 million to $2.1 million in 2011 compared to $4.9 million in 2010 is due to the carved out expense reflecting an allocation for the
initial fleet for the period prior to the IPO in April 2011 and in respect of the Golar Freeze for the period prior to its acquisition in
October 2011. Pursuant to the management and administrative services agreement entered into with Golar Management on March 30,
2011, under which Golar Management provides certain management and administrative services to us and is reimbursed for reasonable
costs and expenses incurred in connection with these services on cost plus 5% recharge basis, we incurred $1.6 million of these
expenses for the year ended December 31, 2011.
Depreciation and amortization: Depreciation and amortization expense increased by $2.6 million to $35.6 million for the
year ended December 31, 2011, compared to $33.1 million for the same period in 2010 mainly due to a full year of depreciation for the
Golar Freeze FSRU capital expenditure in 2011 compared to approximately eight months in 2010 following the completion of its
FSRU retrofitting in May 2010.
Impairment of long-term assets: We incurred an impairment charge of $1.5 million for the year ended December 31, 2010 in
respect of parts ordered for the FSRU conversion project that were not required for the
66
conversion of the Golar Spirit, reflecting a lower recoverable amount for these parts. These parts were retained by Golar and were not
WUDQVIHUUHGWRWKH3DUWQHUVKLSDQGWKHUHIRUHKDYHEHHQHOLPLQDWHGIURPWKH3DUWQHUVKLS¶VHTXLW\SRVLWLRQDVRI$SULO
Interest income: Interest income decreased by $1.8 million to $1.5 million for the year ended December 31, 2011, compared
to $3.3 million in 2010, primarily as a result of:
d The release of the lease security deposit for both the Golar Spirit and the Golar Freeze in connection with the settlement of
their lease obligations at the end of 2010. Consequently, there is no comparable Letter of Credit ³/&´GHSRVLWLQWHUHVWHDUQed
in 2011 compared to LC deposit interest of $1.0 million in 2010; and
d The decline in interest rates in 2011 compared to 2010.
Interest expense: Interest expense increased by $1.9 million to $19.9 million for the year ended December 31, 2011,
compared to $18.0 million in 2010 primarily due to an increase of $3.1 million relating to the interest paid to Golar for the vendor
financing loan in respect of the acquisition of the Golar Freeze LQ2FWREHU3OHDVHUHDG1RWH²'HEW²LQWKHQRWHVWRRXU
consolidated and combined financial statements for a description of the vendor financing loan from Golar. The increase in interest
expense was partially offset by a decrease of $1.3 million primarily due to the settlement of the Golar Spirit and Golar Freeze lease
obligations at the end of 2010 and a decline in interest rates in 2011 compared to 2010.
Other financial items:
Year Ended December 31,
2010
2011
(dollars in thousands)
Change
% Change
Mark-to-market adjustment for interest rate swap derivatives
Interest rate swap cash settlements
Unrealized and realized losses on interest rate swaps
Net foreign currency adjustments for re-translation of lease
related balances and mark-to-market adjustments for the
Winter lease related currency swap derivative
Loss on termination of lease arrangements
Other
Other financial items, net
$
$
(11,725) $
(5,034)
(16,759)
(6,298) $
(7,930)
(14,228)
(766)
²
(2,590)
(20,115) $
(3,316)
(1,758)
(1,327)
(20,629) $
(5,427)
2,896
(2,531)
2,550
1,758
(1,263)
514
86%
(37)%
18%
(77)%
(100)%
(95)%
(2)%
Net unrealized and realized gains (losses) on mark-to-market adjustments for interest rate swap derivatives increased by $2.5
million to $16.8 million in December 31, 2011, compared to $14.2 million in 2010. A factor contributing to the $16.8 million
unrealized and realized losses on mark-to-market adjustments for interest rate swaps in 2011 was our entry into new interest rate swap
agreements with a notional value of $285.9 million. In 2011 and 2010, long term interest rate swap rates declined which led to losses
related to the mark-to-market valuations of interest rate derivatives. We hedge account for certain of our interest rate swaps.
Accordingly, an additional $0.9 million gain was accounted for as a change in other comprehensive income which would have
otherwise been recognized in earnings for the year ended December 31, 2011. Included within mark-to-market adjustments for interest
rate swaps is an unrealized gain of $0.7 million and a loss of $4.0 million for the years ended December 31, 2011 and 2010,
UHVSHFWLYHO\UHSUHVHQWLQJDPRXQWVDOORFDWHGWRXVRQWKHEDVLVRIRXUSURSRUWLRQRI*RODU¶VGHEW
67
Unrealized foreign exchange gains and losses of $0.8 million arose as a result of the retranslation of our capital lease
obligations and the movement in the fair value of the related currency swap used to hedge the Golar Winter lease obligation. Of this
$0.8 million unrealized net foreign exchange loss in 2011, an unrealized loss of $0.9 million (2010: $7.7 million unrealized loss) arose
in respect of the mark-to-market valuation of the Golar Winter currency swap representing the movement in the fair value. This swap
hedges the currency risk arising from lease rentals due in respect of the Golar Winter GBP lease rental obligation, by translating GBP
payments into U.S. Dollar payments at a fixed GBP/USD exchange rate (i.e. the Partnership receives GBP and pays U.S. Dollars). The
unrealized gain on retranslation of the lease obligation in respect of the Golar Winter Lease, which this swap hedges, was $0.2 million
(2010: $4.4 million unrealized gain). The unrealized gain arose due to the marginal depreciation of the U.S. Dollar against the GBP
during the year.
The decrease of $1.8 million relates to the loss on termination of lease financing arrangements in 2010 in respect of the Golar
Freeze obligation.
Other items represent, among other things, bank charges, the amortization of debt related expenses, foreign currency
differences arising on retranslation of foreign currency and gains or losses on short term foreign currency forward contracts.
Income taxes: Income taxes relate primarily to the taxation of our U.K. based vessel operating companies and our Brazilian
subsidiary established in connection with our Petrobras long-term charters. Included within income taxes is a credit of $0.5 million
relating to the amortization of deferred tax benefit on intra-group transfers in relation to the Golar Freeze which was carved out from
the results of Golar for the period prior to the acquisition date of October 19, 2011.
Net income: As a result of the foregoing, we earned net income of $89.5 million in 2011, compared to $71.6 million in 2010.
Non-controlling interest: Non-controlling interest refers to the 40% interest in the Golar Mazo.
Year Ended December 31, 2010 Compared with the Year Ended December 31, 2009
Year Ended December 31,
Total operating revenues
Voyage expenses
Vessel operating expenses
Administrative expenses
Depreciation and amortization
Impairment of long-term assets
Interest income
Interest expense
Other financial items
Taxes
Net income
Non-controlling interest
TCE (to the closest $100)
Average daily vessel operating costs
$
68
2010
% Change
(in thousands except TCE and average daily vessel operating costs)
$
Change
2009
$
182,540
1,950
32,505
5,591
33,068
1,500
3,388
(17,952)
(20,629)
(1,122)
71,611
(9,250)
126,634
4,909
29,762
5,040
28,238
1,500
7,173
(27,306)
16,764
(1,640)
52,176
(9,012)
55,906
(2,959)
2,743
551
4,830
²
(3,785)
9,354
(37,393)
518
19,435
238
44%
(60)%
9%
11%
17%
²
(53)%
(34)%
(223)%
(32)%
37%
3%
106,900
17,811
83,500
16,308
23,400
1,503
28%
9%
Operating days: During the year ended December 31, 2010, our total operating days have increased to 1,690 days compared
to 1,412 days in 2009 as a result of the Golar Winter being on hire for a full year in 2010 and re-delivery of the Golar Freeze in May
2010 pursuant to completion of its FSRU retrofitting.
Operating Revenues: Operating revenues for 2010 increased by $55.9 million to $182.5 million for the year ended December
31, 2010; as compared to $126.6 million in 2009 primarily due to:
d An increase of $32.2 million due to the Golar Winter being on hire for a full year in 2010 compared to only four months in
2009. The Golar Winter commenced its 10 year charter with Petrobras in September 2009 following its FSRU retrofitting;
and
d An increase of $23.0 million due to the Golar Freeze being on hire from May 2010 for approximately eight months in 2010
at a higher FSRU charterhire rate compared to only five months in 2009 operating on a lower charterhire rate as an LNG
carrier. The Golar Freeze commenced its 10 year time charter with DUSUP and was on-hire from May 2010 following its
retrofitting to an FSRU vessel.
2010
2009
Change
% Change
Calendar days less scheduled off-hire days
1,690
1,458
232
Average daily TCE (to the closest $100)
$
106,900 $
83,500 $
23,400
16%
28%
Accordingly, the above resulted in a $23,400 increase in average daily time charter equivalent rates, or TCEs, for the year
ended December 31, 2010 of $106,900, compared to $83,500 in 2009.
Voyage Expenses: Voyage expenses primarily relate to fuel costs associated with commercial waiting time, vessel
positioning costs and charterhire expenses. Voyage expenses decreased by $2.9 million to $2.0 million for the year ended December
31, 2010, as compared to $4.9 million in 2009. The higher costs in 2009 was principally due to (i) the Golar Winter incurring
positioning costs from Singapore to Brazil at our cost following the completion of its FSRU retrofitting in 2009 and (ii) the Golar
Freeze incurring positioning costs from the end of its charter to delivery at the shipyard in June 2009 to commence its FSRU
retrofitting. In 2010, only the Golar Freeze incurred positioning costs from the shipyard to the delivery point to its charterer in Dubai.
Vessel Operating Expenses: Vessel operating expenses for the year ended December 31, 2010 were $32.5 million compared
to $29.8 million in 2009. The increase relates primarily to increased operating costs for both the Golar Winter and the Golar Freeze
due to increased costs for operating them as FSRU vessels. In addition, the Golar Freeze operated for six months as an LNG carrier in
2009 before entering the shipyard for its FSRU retrofitting compared to eight months in 2010 operating as a FSRU. The average daily
vessel costs for the year ended December 31, 2010 was $17,811 compared to $16,308 in 2009.
Administrative Expenses: Administrative expenses increased by $0.6 million to $5.6 million for the year ended December
31, 2010 compared to $5.0 million in 2009. Included within these expenses for the year ended December 31, 2010 and 2009 is $4.9
million and $4.1 million, respectively, representing expenses that were carved out from the administrative expenses of Golar
(including an allocation for stock-based compensation costs) and a portion allocated to us based on the size of our fleet.
Depreciation and amortization: Depreciation and amortization expense have increased by $4.8 million to $33.1 million for
the year ended December 31, 2010 compared to $28.2 million in 2009 primarily due to:
d A full year of depreciation for the Golar Winter FSRU capital expenditures in 2010 compared with approximately four months
in 2009; and
d The commencement of depreciation for the Golar Freeze FSRU retrofitting expenditures following the completion of its
retrofitting in May 2010.
69
Impairment of long-term assets: The impairment charge of $1.5 million in each of the years ended December 31, 2010 and
2009 relates to parts ordered for the FSRU retrofitting project that were not required for the conversion of the Golar Spirit reflecting a
lower recoverable amount for these parts. Some of these parts were used in the retrofitting of the Golar Freeze during 2009. These
assets were retained by Golar and were not transferred to the Partnership and therefore have been eliminated from the PartnershLS¶V
equity position as of April 13, 2011.
Interest income: Interest income decreased by $3.8 million to $3.4 million for the year ended December 31, 2010, compared
to $7.2 million in 2009. This was primarily due to a decrease in the related restricted cash deposits requirement as a result of
additional security provided to the lessors as a result of our entry into long-term charters with the respective vessels. The depreciation
of GBP against the U.S. Dollar also contributed to the decline in the interest income earned on our restricted cash deposits, or LC
deposits, denominated in GBP.
Interest expense: Interest expense for the year ended December 31, 2010 was $18.0 million compared to $27.3 million in
2009. The decrease of $9.4 million is primarily attributable to:
d A decrease of $5.2 million in respect of the impact of the depreciation of GBP against the U.S. Dollar on interest expense on
our lease balances denominated in GBP; and
d A decrease in other debt related interest expense by $4.2 million from $14.9 million in 2009, compared to $10.7 million in
2010 primarily due to lower USD LIBOR interest rates in 2010.
Other financial items:
Year Ended December 31,
2009
2010
Change
% Change
(dollars in thousands)
Mark-to-market adjustment for interest rate
swap derivatives
Interest rate swap cash settlements
Unrealized and realized (losses) gains on
interest rate swaps.
Net foreign currency adjustments for re-
translation of lease related balances and
mark-to-market adjustments for the Winter
lease related currency swap derivative
Loss on termination of lease arrangements
Foreign exchange loss on operations
Other
Other financial items, net
$
$
(6,298) $
(7,930)
14,071
(5,273)
$
(14,228)
8,798
(3,316)
(1,758)
(64)
(1,263)
(20,629) $
15,079
²
(5,395)
(1,718)
16,764
$
(20,369)
(2,657)
(23,026)
(18,395)
(1,758)
5,331
455
(37,393)
(145)%
50%
(262)%
(122)%
100%
(99)%
(26)%
(223)%
Unrealized and realized (losses) gains on interest rate swaps increased by $23.0 million in 2010 compared to 2009. In 2009,
long-term interest rate swap costs increased from 2008 levels resulting in an unrealized gain for the year. In 2010, long term interest
rate swaps declined for the first nine months of the year, and although rising in the fourth quarter, still declined over the year. This
resulted in an unrealized loss in 2010. We hedge account for certain of our interest rate swaps. Accordingly, a further $2.3 million
unrealized loss was accounted for as a change in other comprehensive income which would have otherwise been recognized in
earnings for the year ended December 31, 2010. Included within mark-to-market adjustment for interest rate swaps is a loss of $4.0
million and a gain of $5.3 million for the years ended December 31, 2010 and 2009 respectively, representing amounts allocated to us
RQWKHEDVLVRIRXUSURSRUWLRQRI*RODU¶VGHEW
70
Unrealized foreign exchange gains and losses arise as a result of the retranslation of our capital lease obligations and the
movement in the fair value of the currency swap used to hedge the Golar Winter lease obligation. The unrealized loss of $3.3 million
in 2010 was mainly due to the appreciation of the U.S. Dollar against GBP. Of the $3.3 million net unrealized foreign exchange loss
in 2010, an unrealized loss of $7.7 million (2009: $28.1 million unrealized gain) arose in respect of the mark-to-market valuation of
the Golar Winter currency swap representing the movement in the fair value. This swap hedges the currency risk arising from lease
rentals due in respect of the Golar Winter GBP lease rental obligation, by translating GBP payments into U.S. Dollar payments at a
fixed GBP/USD exchange rate (i.e. the Partnership receives GBP and pays U.S. Dollars). The unrealized gain on retranslation of the
lease obligation in respect of the Golar Winter Lease, which this swap hedges, was $4.4 million (2009: $13.0 million unrealized loss).
The unrealized gain arose due to the depreciation of the U.S. Dollar against the GBP during the year.
The increase of $1.8 million relates to the loss on termination of lease financing arrangements in 2010 in respect of the Golar
Freeze.
Foreign exchange loss on operations pertains to carve-out adjustments allocated to us in both 2010 and 2009 that reflect the
LPSDFWRI*RODU¶VHQWU\LQWRIRUHLJQFXUUHQcy forward contracts in respect of the Golar Winter and the Golar Freeze FSRU retrofitting
expenditure. In 2009, both Golar Winter and Golar Freeze were undergoing their FSRU retrofitting. The Golar Spirit and the Golar
Freeze completed its FSRU retrofitting in September 2009 and May 2010, respectively.
Income taxes: Income taxes relate primarily to the taxation of our U.K. based vessel operating companies and our Brazilian
subsidiary established in connection with our Petrobras long-term charters.
Net income: As a result of the foregoing, we earned net income of $71.6 million in 2010, compared to $52.2 million in 2009.
Non-controlling interest: Non-controlling interest refers to the 40% interest in the Golar Mazo.
B. Liquidity and Capital Resources
Liquidity and Cash Needs
We operate in a capital-intensive industry and we expect to finance the purchase of additional vessels and other capital
expenditures through a combination of borrowings from, and leasing arrangements with, commercial banks, cash generated from
operations and debt and equity financings. In addition to paying distributions, our other short-term liquidity requirements relate to
servicing interest on our debt, scheduled repayments of long-term debt, funding working capital and maintaining cash reserves against
fluctuations in operating cash flows.
Our funding and treasury activities are intended to maximize investment returns while maintaining appropriate liquidity.
Cash and cash equivalents are held primarily in U.S. Dollars with some balances held in British Pounds. We have not used derivative
instruments other than for interest rate and currency risk management purposes.
Sources of short-term liquidity include cash balances, restricted cash balances, short-term investments, available amounts
under revolving credit facilities and receipts from our charters. Revenues from our time charters are generally received monthly in
advance. In addition we benefit from low inventory requirements (consisting primarily of fuel, lubricating oil and spare parts) due to
fuel costs, which represent the majority of these costs being paid for by the charterer under time charters.
Generally, our long-term sources of funds will be cash from operations, long-term bank borrowings and other debt and equity
financings. Because we will distribute the majority of our available cash, we expect that we will rely upon external financing sources,
including bank borrowings and the issuance of debt and equity securities, to fund acquisitions and other expansion capital
expenditures. Occasionally we may enter into vendor financing arrangements with Golar to provide intermediate financing for capital
expenditures until longer-term financing is obtained, at which time we will use all or a portion of the proceeds from the longer-term
financings to prepay outstanding amounts due under these arrangements.
71
We estimate that we will spend in total an average of approximately $28.8 million for drydocking and classification surveys
for each of our five vessels during the five-year period ending December 31, 2016. As our fleet matures and expands, our drydocking
expenses will likely increase. Ongoing costs for compliance with environmental regulations are primarily included as part of our
drydocking and society classification survey costs or are a component of our operating expenses. We are not aware of any regulatory
changes or environmental liabilities that we anticipate will have a material impact on our current or future operations.
As of December 31, 2011, our current liabilities exceeded current assets by $51.9 million. Included within current liabilities
are mark-to-market valuations of swap derivatives representing $54.3 million of these liabilities. We currently have no intention of
terminating these swaps and hence realizing these liabilities.
As of December 31, 2011, our cash and cash equivalents, including restricted cash and short-term investments, was $210.7
million and we had access to undrawn borrowing facilities of $20 million under our revolving credit facility with Golar, which is
available until December 2014. Our restricted cash balances contribute to our short and medium term liquidity as they are used to fund
payment of certain loans and capital leases which would otherwise be paid out of our cash balances. Since December 31, 2011,
significant transactions impacting our cash flows include:
d In February 2012, we paid a cash distribution of $0.43 per unit, an aggregate of $17.1 million, with respect to the
quarter ended December 31, 2011; and
d We made $6.1 million of scheduled debt repayments.
We believe our current resources, including our undrawn revolving credit facility of $20 million, are sufficient to meet our
working capital requirements for at least the next twelve months.
Medium to Long-term Liquidity and Cash Requirements
Our medium to long-term liquidity requirements include funding the acquisition of new vessels, the repayment of long-term
debt and the payment of distributions to our unitholders, to the extent we have sufficient cash from operations after the establishment
of cash reserves and payment of fees.
We have an option to purchase the Nusantara Regas Satu from Golar subsequent to the completion of its FSRU retrofitting
and acceptance by its charterer, PT Nusantara Regas. We expect to exercise this option during 2012. We will finance the purchase of
the Nusantara Regas Satu through borrowings, cash generated from operations or equity issuances, or a combination thereof.
We have also entered into an agreement with Petrobras to make certain modifications to the Golar Winter, in consideration
for an increase in charter hire rates and an extension to the charter term of the Golar Winter. It is expected that the Golar Winter will
enter the shipyard during the second quarter of 2013 and be completed by the third quarter of 2013. The cost of the modifications
together with drydock costs is estimated to be approximately $25 million.
Cash Flows
The following table summarizes our net cash flows from operating, investing and financing activities for the periods
presented:
Net cash provided by operating activities
Net cash (used in) provided by investing activities
Net cash (used in) provided by financing activities
Net increase in cash and cash equivalents
Cash and cash equivalents at beginning of year
Cash and cash equivalents at end of year
72
$
2011
Year Ended December 31,
2010
(dollars in thousands)
2009
$
150,303
(3,544)
(144,897)
1,862
44,100
45,962
$
82,330
170,941
(237,040)
16,231
27,869
44,100
61,832
(123,730)
65,124
3,226
24,643
27,869
In addition to our cash and cash equivalents noted above, as of December 31, 2011 we had short-term restricted cash and
investments of $24.5 million that represents balances retained on restricted accounts in accordance with certain lease and loan
requirements. These balances act as security for, and over time are used to, repay lease and loan obligations. As of December 31,
2011, our long-term restricted cash balances amounted to $140.3 million and represented security for our Methane Princess capital
lease obligation. It will be released over time in connection with the repayment of our lease obligation.
Net Cash Provided by Operating Activities
Net cash provided by operating activities was $150.3 million, $82.3 million and $61.8 million for the years ended December
31, 2011, 2010 and 2009, respectively. The increase of $68.0 million in 2011, compared to 2010, was primarily due to (i) a $15.4
million decrease in amounts due to related parties to $3.1 million as of December 31, 2011 from $18.5 million in December 31, 2010,
primarily due to the net settlement of trading balances due to related parties; (ii) the increased contribution from the Golar Freeze as it
operated under its charter to DUSUP for the full year of 2011, as opposed to approximately eight months in 2010 following its FSRU
retrofitting; and (iii) the higher allocated expenses (carve-out adjustments from Golar) of $16.5 million in 2010 compared to only $3.3
million in 2011. These carve-out adjustments have been accounted for as an equity contribution. Accordingly, these allocated
expenses are presented as an operating activities cash payment with the related equity contribution shown as a financing activities cash
UHFHLSWDQGLQFOXGHGZLWKLQWKHFDSWLRQ³UHSD\PHQWRIRZQHU¶VIXQGLQJ´VXFKWKDWWKHQHWFDVKeffect to the combined statement of
cash flows is $nil.
The increase of $20.5 million in 2010 is principally due to (i) an increased contribution from the Golar Winter having
operated under its FSRU charter for a full year in 2010, compared to approximately four months in 2009; and (ii) the Golar Freeze
operating under its FSRU charter with DUSUP for approximately eight months in 2010 following its FSRU retrofitting, compared to
five months in 2009 operating as a LNG carrier.
Net Cash (Used in) Provided by Investing Activities
Net cash used in investing activities of $3.5 million in 2011 arose due to the increase in restricted cash deposits relating to the
Mazo facility in line with the increased debt repayments leading to its maturity in June 2013.
Net cash provided by investing activities of $170.9 million in 2010 arose due to the release of restricted cash deposits that
were used as security for the Golar Spirit and Golar Freeze lease obligations which were settled during 2010. This was partially
offset by additions to vessels and equipment of $30.2 million in relation to the FSRU retrofitting of the Golar Freeze to a FSRU which
was completed in May 2010.
Net cash used in investing activities of $123.7 million in 2009 was mainly due to additions to vessels and equipment of
$141.3 million comprising of payments in respect of the retrofitting of both the Golar Winter and Golar Freeze to FSRUs. This is
partially offset by the release of $17.6 million from our deposits held as security for our capital lease obligations mainly in recognition
of the additional security provided to the lessor of the Golar Winter by our entry into a long-term charter with Petrobras.
Net Cash (Used in) Provided by Financing Activities
Net cash (used in) provided by financing activities is principally generated from funds from new debt and lease finance and
contributions from owners, partially offset by debt repayments and repayments of invested equity.
Net cash used in financing activities during the year ended December 31, 2011 of $144.9 million was mainly relating to the
following:
d repayments of long-term debt and lease obligations of $50.9 million;
d payment of cash distributions during the year of $29.3 million pursuant to our IPO in April 2011;
d SD\PHQWRIGLYLGHQGVUHODWLQJWRWKH'URSGRZQ3UHGHFHVVRUDQGUHSD\PHQWRIRZQHU¶VIXQGLQJ
73
d DFTXLVLWLRQRI*RODU¶VRZQHUVKLSLQWHUHVWLQ certain subsidiaries which own and operate the Golar Freeze and
hold the secured bank debt. The purchase consideration was $330 million for the vessel and $9 million of working
capital adjustments net of the assumed bank debt of $108 million, resulting in total purchase consideration of
approximately $231 million of which $222.3 million was financed by vendor financing in the form of the Golar
LNG facility.
Net cash used in financing activities during the year ended December 31, 2010 of $237.0 million was primarily in relation to
UHSD\PHQWVRIORQJWHUPGHEWUHSD\PHQWVRIRZQHUV¶IXQGLQJDQGWKHUHSD\PHQWRIWKHGolar Spirit and the Golar Freeze lease
obligations, which were funded from restricted cash deposits held to secure these lease obligations. This was partially offset by the
proceeds from the drawdown on the Golar Freeze facility of $125 million.
Net cash provided by financing activities during the year ended December 31, 2009 of $65.1 million comprised repayments
RIORQJWHUPGHEWDQGRZQHUV¶HTXLW\GXULQJWKH\HDURIIVHWE\the receipt of the final drawdown on the Golar LNG Partners credit
facility of $35 million.
Borrowing Activities
Long-Term Debt. As of December 31, 2011 and 2010, our long-term debt consisted of the following:
Mazo facility
Golar LNG Partners credit facility
Golar Freeze facility
Golar LNG vendor financing loan
Total
Our outstanding debt of $622.9 million as of December 31, 2011, is repayable as follows:
Year Ending December 31,
2012
2013
2014
2015
2016
2017 and thereafter
Total
December 31,
2011
2010
(in thousands)
38,932
257,500
104,142
222,310
622,884
$
$
62,313
267,500
118,151
²
447,964
$
$
(in thousands)
$
$
49,906
50,523
259,848
65,482
28,250
168,875
622,884
As of December 31, 2011, the margins we pay under our bank loan agreements are above LIBOR at a fixed or floating rate
ranging from 0.87% to 3.00%.
Mazo Facility
In November 1997, Osprey, GolaU¶VSUHGHFHVVRUHQWHUHGLQWRDVHFXUHGORDQIacility of $214.5 million in respect of the
vessel, the Golar Mazo. The loan is secured on the vessel Golar Mazo. This facility bears floating rate interest of LIBOR plus a
margin. The loan is repayable in semi-annual installments, which increase from $5.0 million to $13.5 million over the term of the loan
ending in June 2013, at which point the facility will be repaid in full. The debt agreement requires that certain cash balances,
representing interest and principal payments for defined future periods, be held by the trust company during the period of the loan.
These balances are referred in these financial statements as restricted cash. As of December 31, 2011, the value of the deposits
secured was $10.3 million. As of December 31, 2011 and December 31, 2010, $38.9 million and $62.3 million, respectively was
outstanding under the Mazo facility.
74
Golar LNG Partners Credit Facility
In September 2008, we entered into a revolving credit facility with a banking consortium to refinance existing loan facilities
in respect of two of our vessels, the Methane Princess and the Golar Spirit (or the Golar LNG Partners credit facility). The loan is
secured against the Golar Spirit and assignment to the lending bank of a mortgage given to us by the lessors of the Methane Princess
and the Golar Spirit, with a second priority charge over the Golar Mazo.
The Golar LNG Partners credit facility accrues floating interest at a rate per annum equal to LIBOR plus a margin. The
initial draw down amounted to $250 million in November 2008. The total amount outstanding at the time of the refinancing in respect
RIWKHVHWZRYHVVHOV¶UHILQDQFHGIDFLOLWLHVZDVPLOOLRQ:H drew down a further $35.0 million for the period to March 2009. At
the time we entered into the Golar LNG Partners credit facility, such facility provided for available borrowings of up to $285 million.
Pursuant to the terms of the Golar LNG Partners credit facility, the total amount available for borrowing under such facility decreases
by $2.5 million per quarter from June 30, 2009 through December 31, 2012 and by $5.5 million per quarter from March 31, 2013
through December 31, 2017. As of December 31, 2011, the revolving credit facility provided for available borrowings of up to $257.5
million, of which $257.5 million was outstanding. Accordingly, as of December 31, 2011, we have no ability to draw additional
amounts under this facility. The loan has a term of ten years and is repayable in quarterly installments commencing in May 2009 with
a final balloon payment of $137.5 million due in March 2018, its maturity date.
As of December 31, 2011 and 2010, we had long-term debt outstanding of $257.5 million and $267.5 million, respectively,
under the Golar LNG Partners Credit Facility.
The Golar LNG Partners credit facility contains restrictive covenants that require the prior written consent of the lenders or
otherwise restrict our ability to, among other things:
d merge or consolidate with any other person;
d make certain capital expenditures;
d pay distributions to our unitholders;
d terminate or materially amend certain of our charters;
d enter into any other line of business;
d make any acquisitions;
d incur additional indebtedness or grant any liens to secure any of our existing or future indebtedness;
d enter into any sale-leaseback transactions; or
d enter into any transactions with our affiliates
The Golar LNG Partners credit facility prohibits us from paying distributions to our unitholders if we are not in compliance
with certain financial covenants or upon the occurrence of an event of default.
Furthermore, we are required under the credit facility to, among other things, comply with the ISM Code and the ISPS Code
and with all international and local environmental laws and to maintain certain levels of insurance on the Methane Princess and the
Golar SpiritDQGPDLQWDLQWKHYHVVHOV¶FODVVFHUWLILFDWLRQV with no material overdue recommendations.
Sponsor Credit Facility
In connection with our IPO, we entered into a $20.0 million revolving credit facility (or the sponsor credit facility) with
Golar, to be used to fund our working capital requirements. The facility has a term of four years and is
75
interest-free and unsecured. As of December 31, 2011, we had not borrowed under the facility. The sponsor credit facility contains
covenants that require us to, among other things:
d notify Golar of any event which constitutes or may constitute an event of default or which may adversely affect our
ability to perform our obligations under the credit facility; and
d provide Golar with information in respect of our business and financial status as Golar may reasonably require including,
but not limited to, copies of our unaudited quarterly financial statements and our audited annual financial statements.
Golar Freeze Credit Facility
In June 2010, Golar Freeze Holding Co., a subsidiary of Golar, entered into a $125 million credit agreement with a syndicate
of banks, led by DnB NOR Bank ASA as security agent, to refinance conversion costs of the Golar Freeze (or the Golar Freeze credit
facility). The loan is secured against the Golar Freeze with second priority mortgage over the Golar Winter, second priority
assignment of insurances on the Golar Winter, and second priority assignment of earnings from the Golar Winter time charter contract
with Petrobras, net of lease and certain approved currency swap payments to the Golar Winter lessor. In connection with our
acquisition of the Golar Freeze, we assumed all obligations under the Golar Freeze credit facility. As of December 31, 2011, there
was $104.1 million of borrowings outstanding under the Golar Freeze credit facility.
The Golar Freeze credit facility bears interest at a floating rate of LIBOR plus a margin and the additional cost (as defined in
the facility), if any. The facility is split into two tranches, the commercial loan facility and the Exportfinans ASA loan facility.
Exportfinans ASA acted as a lender with a guarantee from GIEK (Garanti-institute for Eksportkredit). Repayments under the
commercial loan facility tranche are due quarterly based on an annuity profile with a final balloon payment of $34.8 million payable in
May 2015. The Exportfinans ASA loan facility tranche is for $50 million with a term of eight years and repayable in equal quarterly
installments with the final payment in June 2018. This tranche is required to be repaid if the commercial tranche is not refinanced.
The Golar Freeze credit facility requires certain cash balances to be held on deposit during the period of the loan. These balances are
referred to in these consolidated financial statements as restricted cash. As of December 31, 2011, the value of the deposit secured
against the loan was $9.0 million.
Under the Golar Freeze credit facility, we are obligated to comply with certain restrictive covenants that will require the prior
written consent of the lenders or otherwise restrict our ability to, among other things:
d merge or consolidate with any other person;
d make certain capital expenditures;
d pay distributions;
d terminate or materially amend the Golar Freeze charter or release the charterer from any obligations under such charter;
d enter into any other line of business other than the ownership, operation and chartering of the Golar Freeze;
d acquire or own certain additional assets;
d enter into any sale and leaseback transactions;
d enter into any transaction with our affiliates.
In addition, we are required under the Golar Freeze credit facility to, among other things, comply with the ISM Code and the
ISPS Code and with all international and local environmental laws and to maintain certain levels of insurance on the Golar Freeze and
maintain its name, registration under the laws of its flag state and class certifications with no material overdue recommendations.
76
The Golar Freeze credit facility prohibits us from paying distributions to our unitholders if we are not in compliance with
certain financial covenants or upon the occurrence of an event of default. The financial covenants under the Golar Freeze credit
facility require us to ensure that as at the end of each quarterly period during and as at the end of each financial year, the ratio of
Charterhire to Consolidated Debt Service is equal to 1.15:1.
Golar LNG Vendor Financing Loan
In connection with our acquisition of the Golar Freeze from Golar in October 2011, we entered into a loan agreement with
Golar for an amount of $222.3 million (or the Golar LNG vendor financing loan). The Golar LNG vendor financing loan is unsecured
and bears interest at a fixed rate of 6.75% per annum payable quarterly. The loan is non-amortizing with the payment of $222.3
million due in October 2014.
Capital Lease Obligations. The following is a summary of our capital lease obligations. As of December 31, 2011, we are
committed to make minimum rental payments under our two capital leases, as follows:
Year ending December 31, (in thousands of $)
2012
2013
2014
2015
2016
2017 and thereafter
Total minimum lease payments
Less: Imputed interest
Present value of minimum lease payments
Methane
Princess
Lease
Golar
Winter Lease
6,985
7,273
7,551
7,844
8,142
244,180
281,975
(133,265)
148,710
$
$
10,002
10,002
10,002
10,002
10,002
155,032
205,042
(85,672)
119,370
$
$
$
$
Total
16,987
17,275
17,553
17,846
18,144
399,212
487,017
(218,937)
268,080
Methane Princess Lease. In August 2003, Golar entered into a finance lease arrangement with the U.K. Lessor. The
obligation to the U.K. Lessor is primarily secured by a letter of credit, which is itself secured by a cash deposit which since June 2008
is now placed with the U.K. Lessor. Lease rentals are payable quarterly. At the end of each quarter the required value of the letter of
credit to secure the present value of rentals due under the lease is recalculated taking into account the rental payment due at the end of
the quarter. The surplus funds in the cash deposits securing the letter of credit, released as a result of the reduction in the required
letter of credit amount are available to pay the lease rentals due at the end of the same quarter. Deficits, if any, are financed by
working capital.
The lease liability under the Methane Princess lease continues to increase until 2014 and thereafter decreases over the period
to 2034 being the primary term of the lease. The value of the deposit used to obtain a letter of credit to secure the lease obligation as
of December 31, 2011 was $145.5 million.
Golar Winter Lease. In April 2004, Golar signed a lease agreement in respect of the Golar Winter, to which we refer to as
the Golar Winter lease, with another U.K. bank (or the Winter Lessor) for a primary period of 28 years. Under the agreement, Golar
received an amount of $166 million. The obligations to the Winter Lessor under the lease were secured by (inter alia) a letter of credit
provided by another U.K. bank (or the LC Bank). During 2008 and 2009, an aggregate amount of $52.4 million was released from this
deposit in consideration of the additional security afforded to the Winter Lessor by the entry of the Golar Winter into a long-term time
charter with Petrobras. As of December 31, 2011, the value of the deposit used to obtain a LC to secure the Golar Winter lease
obligation was $nil.
The Golar Winter lease is denominated in GBP while its cash deposit is denominated in USD. In order to hedge the currency
risk arising from the GBP lease rental obligation, we have entered into a 28 year currency swap, to swap all lease rental payments into
U.S. Dollars at a fixed GBP/USD exchange rate (i.e., we receive GBP and pay U.S. Dollars).
For all our leases, lease rentals include an interest element that is accrued at a rate based upon GBP LIBOR. In relation to the
Golar Winter lease, we have converted our GBP LIBOR interest obligation to USD LIBOR by
77
entering into the cross currency swap referred to above. We receive interest income on our restricted cash deposits at a rate based
upon GBP LIBOR for the Golar Winter lease and the Methane Princess lease. All of our leases are therefore denominated in GBPs.
The majority of this GBP capital lease obligation is hedged by GBP cash deposits securing the lease obligations, in the case of the
Golar Winter lease, or by a currency swap. This is not however a perfect hedge and so the movement in the currency exchange rate
between the U.S. Dollar and the GBP will affect our results.
In the event of any adverse tax changes to legislation affecting the tax treatment of the leases for the U.K. vessel lessors or a
successful challenge by the U.K. Revenue authorities to the tax assumptions on which the transactions were based, or in the event that
we terminate any of our U.K. tax leases before their expiration, we would be required to return all or a portion of, or in certain
circumstances significantly more than, the upfront cash benefits that we have received or that have accrued over time, together with
the fees that were financed in connection with our lease financing transactions, post additional security or make additional payments to
our lessors which would increase the obligations noted above. The Lessor of the Methane Princess has a second priority security
interest in the Methane Princess and the Golar Spirit to secure these potential obligations and similar obligations related to other Golar
vessels. Golar has agreed to indemnify us against any of these increased costs and obligations. Costs related to the Golar Winter
lease, which is with a different Lessor, have not been indemnified by Golar. Golar did not receive any up front cash benefit in respect
of the Golar Winter lease, but rather the benefits accrue over the term of the lease in the form of less expensive financing.
Debt and Lease Restrictions
Our existing financing agreements (debt and leases) impose operating and financing restrictions on us and our subsidiaries,
which may significantly limit or prohibit, among other things, our ability to:
d incur additional indebtedness;
d create liens;
d sell shares of subsidiaries;
d make certain investments;
d engage in mergers and acquisitions;
d purchase and sell vessels;
d transfer funds from subsidiary companies to us;
d enter into, amend or cancel time or consecutive voyage charters; or
d pay distributions to our unitholders without the consent of our lenders and lessors.
In addition, our lenders and lessors may accelerate the maturity of indebtedness under our financing agreements and foreclose
upon the collateral securing the indebtedness upon the occurrence of certain events of default, including our failure to comply with
any of the covenants contained in our financing agreements. Various debt and lease agreements contain covenants that require
compliance with certain financial ratios. Such ratios include equity ratios, working capital ratios and earnings to net debt ratio
covenants, debt service coverage ratios, minimum net worth covenants, minimum value clauses and minimum cash and cash
equivalent restrictions in respect of our subsidiaries and us. The lease with respect to the Golar Winter contains a minimum value
clause that is applicable only if the Golar Winter is not chartered under a time charter acceptable to the lessor for this purpose, such as
the current time charter. The Golar Winter lease generally provides that, in the event that the Golar Winter charter is terminated and
is not replaced with a similar charter, the amount of any obligations outstanding under the Golar Winter lease shall be equal to or less
than 80% of the value of the vessel at the time of any such charter termination. In the event that the minimum value clause becomes
applicable and is not satisfied, the lessee shall either procure a letter of credit in an amount sufficient to cover any deficiency between
the amount that is equal to 80% of the value of the vessel at the time of any such charter termination and the amount of any obligations
78
outstanding under the Golar Winter lease or, if the lessor agrees, provide alternative additional security to the lessor. With respect to
minimum levels of cash and cash equivalents, we have covenanted to maintain at least $10 million of cash and cash equivalents.
As of December 31, 2011, we were in compliance with all the covenants under our various debt agreements, with the
exception of our consolidated net worth covenant under our Golar LNG Partners credit facility. In March 2012, we received a waiver
relating to our requirement to comply with the consolidated net worth covenant as of December 31, 2011 from the lenders under our
Golar LNG Partners credit facility. Absent this waiver, we would not have been in compliance with such covenant as of December 31,
2011 due to the required accounting treatment of our acquisition from Golar of a 100% interest in the subsidiaries that own and
operate the Golar Freeze. Such acquisition is accounted for as a reorganization of entities under common control. Such accounting
treatment requires that the excess of the proceeds we paid over the historical cost of the combining entity be treated as an equity
distribution, which resulted in a $165.8 million reduction in our equity as of December 31, 2011. In connection with the grant of such
waiver, in order to avoid any such default that could occur in the future as a result of acquisitions by us from Golar that may require
accounting as a reorganization of entities under common control, the definition of consolidated net worth contained in such credit
facility has been amended to permit, in connection with up to two such additional acquisitions by us from Golar, the addition to our
consolidated net worth (as defined in such credit facility) of the difference between the original purchase price and the original net
book value (subject to adjustment for depreciation).
In addition to mortgage security, some of our debt is also collateralized through pledges of shares by our guarantor
subsidiaries.
Derivatives
We use financial instruments to reduce the risk associated with fluctuations in interest rates and foreign currency exchange
rates. We have a portfolio of interest rate swaps that exchange or swap floating rate interest to fixed rates, which from a financial
perspective, hedges our obligations to make payments based on floating interest rates. As of December 31, 2011, our interest rate
swap agreements effectively fixed our net floating interest rate exposure on $465.9 million of floating rate debt, leaving $54.0 million
exposed to a floating rate of interest. Our swap agreements have expiration dates between 2013 and 2018 and have fixed rates of
between 0.92% and 5.04%.
As noted above, we have entered into a currency swap to hedge an exposure to GBPs in respect of the Golar Winter lease.
We enter into foreign currency forward contracts in order to manage our exposure to the risk of movements in foreign
currency exchange rate fluctuations. We also receive some of the revenue in respect of the Golar Spirit and Golar Winter charters in
Brazilian Reais. We are affected by foreign currency fluctuations primarily through our FSRU projects, expenditures in respect of our
ships drydocking, some operating expenses including the effect of paying the majority of our seafaring officers in Euros and some of
our administrative costs. The currencies which impact us the most include, but are not limited to, Euro, Norwegian Kroner, Singapore
Dollars and, to a lesser extent, British Pounds.
Capital Commitments
Possible Acquisitions of Other Vessels
Although we do not currently have in place any agreements relating to acquisitions of other vessels (other than our option to
purchase the Nusantara Regas Satu pursuant to the omnibus agreement), we assess potential acquisition opportunities on a regular
basis. Pursuant to our omnibus agreement with Golar, we will have the opportunity to purchase additional LNG carriers and FSRUs
from Golar when those vessels are fixed under charters of five or more years upon their expiration of their current charters. Subject to
the terms of our loan agreements, we could elect to fund any future acquisitions with equity or debt or cash on hand or a combination
of these forms of consideration. Any debt incurred for this purpose could make us more leveraged and subject us to additional
operational or financial covenants.
79
Modifications to the Golar Winter
We have agreed to make certain modifications to the Golar Winter, including the addition of LNG loading arms, as a result
RI3HWUREUDV¶GHFLVLRQWRUHORFDWHWKHGolar Winter, from Rio de Janeiro to Bahia. We expect to enter into an agreement with Golar,
under which Golar will undertake the modification work, which began with the ordering of long lead items in the first quarter of 2012
and is expected to be completed by the third quarter of 2013. We currently expect the cost of these modifications together with the
drydocking cost to be approximately $25 million, which we expect to fund with a combination of cash and undrawn credit facilities or
future debt or equity transactions.
Critical Accounting Policies
The preparation of our consolidated and combined financial statement in accordance with U.S. GAAP requires that
management make estimates and assumptions affecting the reported amounts of assets and liabilities and disclosure of contingent
assets and liabilities at the date of the financial statements and the reported amounts of revenues and expenses during the reporting
period. The following is a discussion of the accounting policies applied by us that are considered to involve a higher degree of
judgment in their application. Please read Note 2 (Summary of Significant Accounting Policies) of our consolidated and combined
financial statements and consolidated and combined financial statements included elsewhere in this Annual Report.
Revenue Recognition
Our revenues include minimum lease payments under time charters, fees for repositioning vessels as well as the
reimbursement of certain vessel operating and drydocking costs. We record revenues generated from time charters, which we classify
as operating leases, over the term of the charter as service is provided.
We recognize the reimbursement for drydocking costs evenly over the period to the next drydocking, which is generally
between two to five years. We recognize repositioning fees (which are included in time charter revenue) received in respect of time
charters at the end of the charter when the fee becomes fixed and determinable. However, where there is a fixed amount specified in
the charter, which is not dependent upon redelivery location, we will recognize the fee evenly over the term of the charter. Where a
vessel undertakes multiple single voyage time charters, revenue is recognized, including the repositioning fee if fixed and
determinable, on a discharge-to-discharge basis. Under this basis, revenue is recognized evenly over the period from departure of the
vessel from its last discharge port to departure from the next discharge port.
Depreciation and Amortization
Depreciation and amortization expense, or the periodic cost charged to our income for the reduction in usefulness and long-
term value of our ships, is related to the number of vessels we own or operate under long-term capital leases. We depreciate the cost
of our owned vessels, less their estimated residual value, and amortize the amount of our capital lease assets over their estimated
economic useful lives, on a straight-line basis, which we estimate at the start of 2012 to be approximately 19 years, 28 years, 32 years,
33 years and 16 years for the Golar Spirit, the Golar Mazo, the Methane Princess, the Golar Winter and the Golar Freeze,
respectively. The economic life for LNG carriers operated worldwide has generally been estimated to be 40 years. On this basis, the
Golar Spirit would, therefore, have a remaining useful life of 10 years. However, the Golar Spirit and the Golar Freeze have been
converted into FSRUs and have been moored in sheltered waters where fatigue loads on their hulls are significantly reduced compared
to loads borne in connection with operation in a worldwide trade pattern. We believe that these factors support our estimate that the
Golar Spirit and the Golar Freeze will remain operational until they are 50 years old and will therefore have remaining useful
economic lives of approximately 20 years, each. We amortize our deferred drydocking costs over two to five years based on each
YHVVHO¶VQH[WDQWLFLSDWHGGU\GRFNLQJ
Vessels and Impairment
Our vessels are reviewed for impairment whenever events or changes in circumstances indicate that the carrying amount may
not be recoverable. In assessing the recoverability of our vesseOV¶FDUU\LQJDPRXQWVZHPXVWPDNHDVVXPSWLRQVUHJDUGLQJHVWLPated
future cash flows and estimates in respect of residual or scrap value. We
80
estimate those future cash flows based on the existing service potential of our vessels. As of December 31, 2011, we did not perform
an impairment test as no trigger events have been identified.
In the event of an impairment trigger, we follow a traditional present value approach, whereby a single set of future cash
flows is estimated. If the carrying value of a vessel were to exceed the undiscounted future cash flows, we would write the vessel
down to its fair value, which is calculated by using a risk-adjusted rate of interest. Since inception, our vessels have not been
impaired. However, for the years ended 2011, 2010 and 2009 we incurred impairment charges of $nil, $1.5 million and $1.5 million,
respectively, in respect of parts ordered for the FSRU conversion project that were not required for the conversion of the Golar Spirit.
Some of these parts have been used by Golar for other FSRU projects but these parts were not transferred to us by Golar.
Vessel Market Values
,Q³²9HVVHOVDQG,PSDLUPHQW´DERYHZHGLVFXVVRXUSROLF\IRUDssessing impairment of the carrying values of our vessels.
During the past few years, the market values of certain vessels in the worldwide fleet have experienced particular volatility, with
substantial declines in many vessel classes. There is a future risk that the sale value of certain of our vessels could decline below
WKRVHYHVVHOV¶FDUU\LQJYDOXHHYHQWKRXJKwe would not impair those veVVHOV¶FDUU\LQJYDOXHXQGHr our accounting impairment policy,
due to our belief that future undiscounted cash flows expected to be earned by such vessels over their operating lives would exceed
VXFKYHVVHOV¶FDUU\LQJDPRXQWV
With respect to ascertaining the fair market value of our owned vessels, we believe that the LNG carrier and FSRU markets
are illiquid, difficult to observe and therefore judgmental. Our valuation approach is to make an estimate of future net cash flows,
with particular respect to cash flows derived from preexisting contracts with counterparties. The principal assumptions we have used
are:
d Cash flows are assumed to be in line with pre-existing contracts and are utilized based on historical performance levels;
d For our LNG carriers, once the initial contract period expires, we have estimated cash flows at the lower of our estimated
current long-term charter rate or option renewal rate with the existing counterparty;
d For our FSRUs, once the initial contract period expires, we have estimated cash flows at the existing contract option
renewal rate, given the lack of pricing transparency in the market as a whole;
d We have used a discount rate applied to future cash flows equivalent to our estimated incremental borrowing rate,
assuming 10 year interest swap rates plus a market risk premium; and
d We have made certain assumptions in relation to the scrap values of our vessels at the end of their useful lives.
While we intend to hold and operate our vessels, were we to hold them for sale, we do not believe that the fair market value
of any of our owned vessels would be lower than their respective historical book values presented as of December 31, 2011. Our
estimates of fair market values assume that we would sell each of our owned vessels in the current environment, on industry standard
terms, in cash transactions, and to a willing buyer where we are not under any compulsion to sell, and where the buyer is not under
any compulsion to buy. For purposes of this calculation, we have assumed that each owned vessel would be sold at a price that
reflects our estimate of its current fair market value. However, we are not holding any of our vessels for sale. Our estimates of fair
market values assume that our vessels are all in good and seaworthy condition without need for repair and if inspected would be
certified in class without notations of any kind. As we obtain information from various sources of objective data and internal
assumptions, our estimates of fair market value are inherently uncertain. In addition, vessel values are highly volatile; as such, our
estimates may not be indicative of the current or future fair market value of our vessels or prices that we could achieve if we were to
sell them.
81
Time Charters
We account for time charters of vessels to our customers as operating leases and rHFRUGWKHFXVWRPHUV¶OHDVHSD\PHQWVDV
time charter revenues. We evaluate each contract to determine whether or not the time charter should be treated as an operating or
FDSLWDOOHDVHZKLFKLQYROYHVHVWLPDWHVDERXWRXUYHVVHOV¶UHPDining economic useful lives, the fair value of our vessels, the likelihood
of a lessee renewal or extension, incremental borrowing rates and other factors.
Our estimate of the remaining economic useful lives of our vessels is based on the common life expectancy applied to similar
vessels in the FSRU and LNG shipping industries. The fair value of our vessels is derived from our estimate of expected present
value, and is also benchmarked against open market values considering the point of view of a potential buyer. The likelihood of a
lessee renewal or extension is based on current and projected demand and prices for similar vessels, which is based on our knowledge
of trends in the industry, historic experience with customers inDGGLWLRQWRNQRZOHGJHRIRXUFXVWRPHUV¶UHTXLUHPHQWV7KH
incremental borrowing rate we use to discount expected lease payments and time charter revenues are based on the rates at the time of
entering into the agreement.
A change in our estimates might impact the evaluation of our time charters, and require that we classify our time charters as
capital leases, which would include recording an asset similar to a loan receivable and removing the vessel from our balance sheet.
The lease payments to us would reflect a declining revenue stream to take into account our interest carrying costs, which would impact
the timing of our revenue stream.
Capital Leases
As at December 31, 2011, we leased two vessels in respect of two refinancing transactions where we sold the vessels and
subsequently leased the vessels from UK financial institutions that routinely enter into finance leasing arrangements. We have
accounted for these arrangements as capital leases. As identified in our critical accounting policy for time charters, we make estimates
and assumptions in determining the classification of our leases. In addition, these estimates, such as incremental borrowing rates and
the fair value or remaining economic lives of the vessels, impact the measurement of our vessels and liabilities subject to the capital
leases. Changes to our estimates could affect the carrying value of our lease assets and liabilities, which could impact our results of
operations. To illustrate, if the incremental borrowing rate had been lower than our initial estimate this would result in a higher lease
liability being recorded due to a lower discount rate being applied to its future lease rental payments.
2QHRIRXUFDSLWDOOHDVHVLVµIXQGHG¶YLDDORQJWHUPFDVKGHSRVLW which closely matches the lease liability. Future changes in
the lease liability arising from interest rate changes are only partially offset by changes in interest income on the cash deposit, and
where differences arise this is funded by, or released to, available working capital.
We have also recorded deferred credits in connection with this lease transaction. The deferred credits represent the upfront
cash inflow derived from undertaking financing in the form of UK leases. The deferred credits are amortized over the remaining
economic lives of the vessels to which the leases relate on a straight-line basis. The benefits under lease financings are derived
primarily from tax depreciation assumed to be available to lessors as a result of their investment in the vessels. If that tax depreciation
ultimately proves not to be available to the lessor, or is clawed back from the lessor (e.g., on a change of tax law or adverse tax
ruling), the lessor will be entitled to adjust the rentals under the relevant lease so as to maintain its after tax position, except in limited
circumstances. Golar has agreed to indemnify us against any increased costs related to the Methane Princess lease (but not the lease
for the Golar Winter). We would be liable for these costs to the extent Golar is unable to indemnify us.
Valuation of Derivative Financial Instruments
Our risk management policies permit the use of derivative financial instruments to manage foreign currency fluctuation and
interest rate. Changes in fair value of derivative financial instruments that are not designated as cash flow hedges for accounting
purposes are recognized in earnings in the consolidated statement of income (loss). Changes in fair value of derivative financial
instruments that are designated as cash flow hedges for accounting purposes are recorded in other comprehensive income (loss) and
are reclassified to earnings in the consolidated statement of income (loss) when the hedged transaction is reflected in earnings.
Ineffective portions of
82
the hedges are recognized in earnings as they occur. During the life of the hedge, we formally assess whether each derivative
designated as a hedging instrument continues to be highly effective in offsetting changes in the fair value or cash flows of hedged
items. If it is determined that a hedge has ceased to be highly effective, we will discontinue hedge accounting prospectively.
The fair value of our derivative financial instruments is the estimated amount that we would receive or pay to terminate the
DJUHHPHQWVLQDQDUP¶VOHQJWKtransaction under normal business conditions at the reporting date, taking into account current interest
rates and foreign exchange rates, and estimates of the current credit worthiness of both us and the swap counterparty. Inputs used to
determine the fair value of our derivative instruments are observable either directly or indirectly in active markets. The process of
determining credit worthiness is highly subjective and requires significant judgment at many points during the analysis.
If our estimates of fair value are inaccurate, this could result in a material adjustment to the carrying amount of derivative
asset or liability and consequently the change in fair value for the applicable period that would have been recognized in earnings or
comprehensive income.
Recently Issued Accounting Standards
Adoption of New Accounting Standards
In January 2010, the FASB issued authoritative guidance that changes the disclosure requirements for fair value
measurements using significant unobservable inputs (Level 3). The updated guidance requires that Level 3 disclosures present
information about purchases, sales, issuances and settlements on a gross basis. The disclosure requirements for the treatment of
purchases, sales, issuances, and settlements in the roll forward of activity in Level 3 fair value measurements are effective for fiscal
years beginning after December 15, 2010, and for interim periods within those fiscal years. We adopted the guidance in the first
quarter of 2011, which did not have a material impact on our consolidated and combined financial statements.
In April 2011, the FASB issued authoritative guidance to clarify when a modification or restructuring of a receivable
constitutes a troubled debt restructuring. In evaluating whether such a modification or restructuring constitutes a troubled debt
restructuring, a creditor must separately conclude that two conditions exist: (1) the modification or restructuring constitutes a
concession and (2) the debtor is experiencing financial difficulties. The guidance is effective for our interim and annual reporting
periods beginning after June 15, 2011. The adoption of this newly issued guidance did not have anLPSDFWRQWKH3DUWQHUVKLS¶V
consolidated and combined financial statements.
New Accounting Standards Not Yet Adopted
In May 2011, the FASB amended existing guidance to achieve consistent fair value measurements and to clarify certain
disclosure requirements for fair value measurements. The new guidance includes clarification about when the concept of highest and
best use is applicable to fair value measurements, requires quantitative disclosures about inputs used and qualitative disclosures about
the sensitivity of fair value measurements using unobservable inputs (Level 3 in the fair value hierarchy), and requires the
classification of all assets and liabilities measured at fair value in the fair value hierarchy (including those assets and liabilities which
are not recorded at fair value but for which fair value is disclosed). The guidance will be effective for our interim and annual
reporting periods beginning after December 15, 2011. We are evaluating the impact of the adoption of this newly issued guidance but
we do not expect it to have a material impact on our consolidated financial statements.
In June 2011, the FASB amended guidance on the presentation of comprehensive income in financial statements. The new
guidance allows entities to present components of net income and other comprehensive income in one continuous statement, referred
to as the statement of comprehensive income, or in two separate but consecutive statements, and removes the current option to report
other comprehensive income and its components in the statement of changes in equity. Under the two-statement approach, an entity is
required to present components of net income and total net income in the statement of net income. The amendments in this update do
not change the items that must be reported in other comprehensive income or when an item of other comprehensive income must be
reclassified to net income. The amendments in this update are effective for fiscal years, and interim periods within those years,
beginning after December 15, 2011. In January 2012, the FASB deferred the effective date for changes
83
in the above guidance that relate to the presentation of reclassification adjustments out of Accumulated Other Comprehensive Income.
The Partnership is evaluating the impact of the adoption of this guidance but does not expect it to have a material impact on its
consolidated financial statements.
In September 2011, the FASB amended guidance on the procedure for testing goodwill for impairment. The amended
guidance permits an entity to first assess qualitative factors to determine whether it is more likely than not that the fair value of a
reporting unit is less than its carrying amount as a basis for determining whether it is necessary to perform the two-step goodwill
impairment test described in Topic 350. The more-likely-than-not threshold is defined as having a likelihood of more than 50 percent.
The amendments include a number of events and circumstances for an entity to consider in conducting the qualitative assessment. The
amendments in this update are effective for annual and interim goodwill impairment tests performed for fiscal years beginning after
December 15, 2011. Early adoption is permitted. The amended guidance will have no impact on the PartneUVKLS¶VFRQVROLGDWHG
financial statements.
In December 2011, the FASB amended guidance on disclosures about offsetting assets and liabilities. The amendments
require an entity to disclose information about offsetting and related arrangements to enable users of its financial statements to
understand the effect of those arrangements on its financial position. The amendments will enhance disclosures required by US GAAP
by requiring improved information about financial instruments and derivative instruments that are either offset or subject to an
enforceable master netting arrangement or similar agreement, irrespective of whether they are offset in accordance with US GAAP.
7KLVLQIRUPDWLRQZLOOHQDEOHXVHUVRIDQHQWLW\¶VILQDQFLDOVWDWHPents to evaluate the effect or potential effect of netting arrangements
RQDQHQWLW\¶VILQDQFLDOSRVLWLRQLQFOXGLQJWKHHIIHFWRUSRWHQWLDOHIIHFWRIQHWWLQJDUUDQJHPHQWVRQDQHQWLW\¶VILQDQFLDOSRsition,
including the effect or potential effect of rights of setoff associated with certain financial instruments and derivative instruments in the
scope of this Update. The amendments will be required for annual reporting periods beginning on or after January 1, 2013, and interim
periods within those annual periods. An entity should provide the disclosures required by those amendments retrospectively for all
comparative periods presented. Adoption of this amended guidance will result in additional disclosures in the financial statements of
the Partnership.
C. Research and Development
Not applicable.
D. Trend Information
3OHDVHVHHWKHVHFWLRQRI,WHPHQWLWOHG³0DUNHW2YHUYLHZDQG7UHQGV´
E. Off-Balance Sheet Arrangements
At December 31, 2011, we do not have any off balance-sheet arrangements.
84
F. Tabular Disclosure of Contractual Obligations
Contractual Obligations
The following table sets forth our contractual obligations for the periods indicated as of December 31, 2011 (in millions):
Long-term debt(1)
Interest commitments on long-term debt - floating(2)
Interest commitments on long-term debt - fixed(3)
Capital lease obligations
Interest commitments on capital lease obligations(2)(4)
Other long-term liabilities(5)
Total
Total
Obligation
622.9
$
37.2
41.3
268.1
218.9
²
$ 1,188.4
$
$
Due in
2012
50.0
9.0
15.0
2.8
14.1
²
90.9
Due in
²
310.4
13.7
26.3
7.0
27.9
²
385.3
$
$
Due in
²
93.7
10.2
²
9.0
27.0
²
139.9
$
$
Due
Thereafter
168.8
$
4.3
²
249.3
149.9
²
572.3
$
(1) As of December 31, 2011, taking into account the hedging effect of our interest rate swaps, $54.0 million of our long-term debt
and capital lease obligations, net of restricted cash deposits, was floating rate debt which accrued interest based on U.S. Dollar
(USD) LIBOR.
(2) Our interest commitment on our long-term debt is calculated based on an assumed average USD LIBOR of 1.22% and taking
into account our various margin rates and interest rate swaps associated with each debt. Our interest commitment on our
capital lease obligations is calculated on an assumed average GBP LIBOR of 5.2%.
(3) This is calculated based on the Golar LNG vendor financing loan fixed rate of 6.75%.
(4) In the event of any adverse tax rate changes or rulings our lease obligations could increase significantly (please read the
GLVFXVVLRQDERYHXQGHU³²/LTXLGLW\DQG&DSLWDO5HVRXUFHV²%RUURZLQJ$FWLYLWLHV²&DSLWDO/HDVH2EOLJDWLRQV´+RZHYHU
Golar has agreed to indemnify us against any such increase (other than any increase related to the Golar Winter lease).
(5) Our consolidated balance sheet as of December 31, 2011 includes $19.2 PLOOLRQFODVVLILHGDV³2WKHUORQJWHUPOLDELOLWLHV´
which represents deferred credits. These liabilities have been excluded from the above table as the timing and/or the amount of
any cash payment is uncertain.
G. Safe Harbor
6HH³&DXWLRQDU\6WDWHPHQW5HJDUGLQJ)RUZDUG/RRNLQJ6WDWHPHQWV´
85
Item 6. Directors, Senior Management and Employees
A. Directors and Senior Management
Directors
The following provides information about each of our directors as of April 20, 2012. The business address for these
individuals is Par-la-Ville Place, 14 Par-la-Ville Road, Hamilton HM 08, Bermuda.
Name
Kate Blankenship
7RU2ODY7U¡LP
Hans Petter Aas
Paul Leand Jr.
Georgina Sousa
Bart Veldhuizen
Age
47
49
66
45
62
45
Position
Director and Audit Committee Member
Chairman of the Board of Directors
Director and Audit Committee Member
Director and Conflicts Committee Member
Director and Secretary
Director, Conflicts Committee Member and Audit Committee Member
Kate Blankenship has served on our board of directors since her appointment in September 2007. Ms. Blankenship has
served as a director of Golar since July 2003 and Golar Energy since June 2009. Ms. Blankenship also served as Company Secretary
of Golar from its inception in 2001 until November 2005. Ms. Blankenship has also been a director of Frontline Limited (or
Frontline) since August 2003 and served as Chief Accounting Officer and Secretary of Frontline from 1994 and October 2005.
Ms. Blankenship has served as a director of Ship Finance International Limited since July 2003, Seadrill Limited since May 2005,
Golden Ocean Group Limited since November 2004 and Archer Limited since August 2007. She is a member of the Institute of
Chartered Accountants in England and Wales.
7RU2ODY7U¡LP has served on our board of directors since his appointment in January 2009 and is also a director of Golar.
0U7U¡LPZDVDSSRLQWHG&KDLUPDQRIRXUERDUGRIGLUHFWRUVLQ0DUFK0U7U¡LPJUDGXDWHGDV M.Sc Naval Architect from the
University of Trondheim, Norway in 1985. He was formerly an Equity Portfolio Manager with Storebrand ASA (1987-1990), and
Chief Executive Officer for the Norwegian Oil Company DNO AS (1992-1995). Since 1995 Mr. Troim has been a director of
Seatankers Management in Cyprus. Mr. Troim serves as a director of and Chairman of ITCL, a director of Seadrill Limited, Golden
Ocean Group Limited, Golden State Petro (IOM I-A) Plc, Archer Limited and as an alternate director of Frontline Ltd.
Hans Petter Aas has served on our board of directors since his appointment in March 2011. Mr. Aas has served as a director
of Golar since September 2008. Mr. Aas has had a long career as a banker in the international shipping and offshore market, and
retired from his position as Global Head of the Shipping, Offshore and Logistics Division of DnB NOR in August 2008. He joined
DnB NOR (then Bergen Bank) in 1989, and has previously worked for the Petroleum Division of the Norwegian Ministry of Industry
and the Ministry of Energy, as well as for Vesta Insurance and Nevi Finance. Mr. Aas is also a director and Chairman of Ship Finance
and Knutsen NYK Offshore Tanker AS, a director of Gearbulk Holding Ltd, and has recently become a director of the Norwegian
Export Credit Guaranty Institute.
Paul Leand Jr. has served on our board of directors since his appointment in March 2011. Mr. Leand has been a Director of
NYSE-listed Ship Finance International Limited since 2003. Mr. Leand has served as the Chief Executive Officer and Director of
AMA Capital Partners LLC, or AMA, an investment bank specializing in the maritime industry since 2004. From 1989 to 1998
Mr. Leand served at the First National Bank of Maryland where he managed its Railroad Division and its International Maritime
Division. He has worked extensively in the U.S. capital markets in connection ZLWK$0$¶VUHVWUXFWXUing and mergers and
acquisitions practices. Mr. Leand serves as a member of AmeriFDQ0DULQH&UHGLW//&¶V&UHGLW&Rmmittee and served as a member
of the Investment Committee of AMA Shipping Fund I, a private equity fund formed and managed by AMA. Mr. Leand holds a
%6%$IURP%RVWRQ8QLYHUVLW\¶V6FKRRORI0DQDJHPHQWDQGLVDGLrector of publicly listed SEA CO LTD and privately held Helm
Financial Corporation and GE SEACO SRL.
Georgina E. Sousa has served on our board of directors since her appointment in September 2007 and has served as our
secretary since her appointment in April 2011. Ms. Sousa has also served as Secretary of Golar LNG
86
Limited and its subsidiaries (including Golar Energy) since November 30, 2005. She is also Head of Corporate Administration for
Frontline. Up until January 2007, she was Vice-President-Corporate Manager of Corporate Administration. From 1976 to 1982 she
was employed by the Bermuda law firm of Appleby, Spurling & Kempe as a Company Secretary and from 1982 to 1993 she was
employed by the Bermuda law firm of Cox & Wilkinson as Senior Company Secretary.
Bart Veldhuizen has been working in the shipping industry since 1994 on both the banking and non banking side.
Mr. Veldhuizen is a founding director in Breakwater Capital Ltd. Breakwater Capital is an investment and advisory company in
London focusing on the maritime industry. From August 2007 until October 2011, he has been the Managing Director & Head of
Shipping of Lloyds Banking. In this capacity, Mr. Veldhuizen maQDJHGWKHFRPELQHG/OR\GV%DQNDQG%DQNRI6FRWODQG¶V86'
billion shipping loan and lease portfolio. He started his career with Van Ommeren Shipping, a Dutch public shipping & storage
company after which he joined DVB bank as a shipping banker working in both Rotterdam and Piraeus. In 2000, he joined Smit
International, a publicly listed Maritime service provider active in Salvage, Marine Contracting and Harbour Towage. After working
for Smit in both Greece and Singapore, Mr. Veldhuizen returned to the Netherlands in August 2003 to work with NIBC Bank, a Dutch
based merchant bank. Mr. Veldhuizen holds a degree in Business Economics from the Erasmus University in Rotterdam, the
Netherlands.
Executive Officers
Other than our Secretary, we currently do not have any executive officers and rely on the executive officers and directors of
Golar Management who perform executive officer services for our benefit pursuant to the management and administrative services
agreement and who are responsible for our day-to-day management subject to the direction of our board of directors. Golar
Management also provides certain commercial and technical management services to our fleet. The following provides information
about each of the executive officers of Golar Management who perform executive officer services for us and who are not also
members of our board of directors as of March 31, 2012. The business address for our executive officers is Par-la-Ville Place, 14 Par-
la-Ville Road, Hamilton HM 08, Bermuda.
Name
Graham Robjohns
Brian Tienzo
Tom Christiansen
Age
Position
47
38
59
Principal Executive Officer
Principal Financial and Accounting Officer
Head of Technical Operations
Graham Robjohns has acted as our Principal Executive Officer since July 2011. From April 2011 to July 2011, Mr.
Robjohns served as our Chief Executive Officer and Chief Financial Officer. Mr. Robjohns served as the Chief Financial Officer of
Golar Management from November 2005 until June 2011. Mr. Robjohns also served as Chief Executive Officer of Golar LNG
Management from November 2009 until July 2011. Mr. Robjohns served as Group Financial Controller of Golar Management from
May 2001 to November 2005 and as Chief Accounting Officer of Golar Management from June 2003 until November 2005. He was
the Financial Controller of Osprey Maritime (Europe) Ltd from March 2000 to May 2001. From 1992 to March 2000 he worked for
Associated British Foods Plc. and then Case Technology Ltd (Case), both manufacturing businesses, in various financial management
positions and as a director of Case. Prior to 1992, Mr. Robjohns worked for PricewaterhouseCoopers in their corporation tax
department. He is a member of the Institute of Chartered Accountants in England and Wales.
Brian Tienzo has acted as our our Principal Financial and Accounting Officer since July 2011. Mr. Tienzo was our
Controller from April 2011 until July 2011. Mr. Tienzo has also served as the Chief Financial Officer of Golar Management since
July 2011 and as the Group Financial Controller of Golar Management since 2008. Mr. Tienzo joined Golar Management in
February 2001 as the Group Management Accountant. From 1995 to 2001 he worked for Z-Cards Europe Limited, Parliamentary
Communications Limited and Interoute Communications Limited in various financial management positions. He is a member of the
Association of Certified Chartered Accountants.
Tom Christiansen acts as our Head of Technical Operations and currently serves as Vice President, Operations of Golar
Management. Mr. Christiansen joined Golar Management in September 2006 as Fleet Manager. Prior to joining Golar Management
he held the position of Fleet Manager responsible for the LNG carrier fleet of Wilhelmsen Ship Management. Mr. Christiansen has a
GHJUHHIURP7¡QVEHUJ1DXWLFDOFROOHJH+HVSHQW
87
years as a chief engineer at Havtor Management until 1995 when it became a part of Bergesen d.y. ASA. Mr. Christiansen remained
with Bergesen as a chief engineer on LPG and LNG carriers until he became a Superintendent responsible for LPG and LNG vessels
in 1995.
B. Compensation
Reimbursement of Expenses of Our General Partner
Our general partner does not receive compensation from us for any services it provides on our behalf, although it will be
entitled to reimbursement for expenses incurred on our behalf. In addition, we will reimburse Golar Management for expenses
incurred pursuant to the management and administrative servicesDJUHHPHQW3OHDVHUHDG³,WHP²0DMRU8QLWKROGHUVDQG5HODWHG
3DUW\7UDQVDFWLRQV²0DQDJHPHQWDQG$GPLQLVWUDWLYH6HUYLFHV$JUHHPHQW´
Executive Compensation
We did not pay any compensation to our directors or officers or accrue any obligations with respect to management incentive
or retirement benefits for our directors and officers prior to our initial public offering. Under the management and administrative
services agreement, we reimburse Golar Management for its reasonable costs and expenses incurred in connection with the provision
of executive officer and other administrative services to us. In addition, we pay Golar Management a management fee equal to 5% of
its costs and expenses incurred on our behalf. During the year ended December 31, 2011, we paid Golar Management $1.6 million in
connection with the provision of these services to us.
Golar Management compensates Mr. Robjohns, Mr. Christiansen and Mr. Tienzo in accordance with its own compensation
policies and procedures. We will not pay any additional compensation to our officers. Officers and employees of affiliates of our
general partner may participate in employee benefit plans and arrangements sponsored by Golar, our general partner or their affiliates,
including plans that may be established in the future
Compensation of Directors
Our officers or officers of Golar who also serve as our directors do not receive additional compensation for their service as
directors but may receive director fees in lieu of other compensation paid by Golar. Each non-management director receives
compensation for attending meetings of our board of directors, as well as committee meetings. Non-management directors each
receive a director fee of between $50,000 per year. Members of the audit and conflicts committees each receive a committee fee of
$10,000 per year. In addition, each director is reimbursed for out-of-pocket expenses in connection with attending meetings of the
board of directors or committees. Each director is fully indemnified by us for actions associated with being a director to the extent
permitted under Marshall Islands law.
During the year ended December 31, 2011 (pro-rated from the date of our IPO), we paid to our directors aggregate cash
compensation of approximately $0.2 million. We do not have a retirement plan for members of our management team or our directors.
C. Board Practices
General
Our current board of dirHFWRUVFRQVLVWVRIVL[PHPEHUVDSSRLQWHGE\RXUJHQHUDOSDUWQHU.DWH%ODQNHQVKLS7RU2ODY7U¡LP
Georgina Sousa, Hans Petter Aas, Paul Leand Jr. and Bart Veldhuizen. Our board has determined that Ms. Blankenship, Mr. Aas,
Mr. Leand and Bart Veldhuizen satisfy the independence standards established by The Nasdaq Stock Market LLC as applicable to us.
Following our first annual meeting of unitholders, our board will consist of seven members, three of whom will be appointed by our
general partner in its sole discretion and four of whom will be elected by our common unitholders. At least three of the elected
directors will meet the independence standards established by The Nasdaq Stock Market LLC. Directors appointed by our general
partner will serve as directors for terms determined by our general partner. Directors elected by our common unitholders are divided
into three classes serving staggered three-year terms. Three of the current six directors appointed by our
88
general partner will serve until our annual meeting in 2012, at which time they will be replaced by four directors elected by our
common unitholders. One of the four directors elected by our common unitholders will be designated as the Class I elected director
and will serve until our annual meeting of unitholders in 2013, another of the four directors will be designated as the Class II elected
director and will serve until our annual meeting of unitholders in 2014, and the remaining two directors will be designated as our
Class III elected directors and will serve until our annual meeting of unitholders in 2015. At each subsequent annual meeting of
unitholders, directors will be elected to succeed the class of directors whose terms have expired by a plurality of the votes of the
common unitholders. Directors elected by our common unitholders will be nominated by the board of directors or by any limited
partner or group of limited partners that holds at least 10% of the outstanding common units.
Each outstanding common unit is entitled to one vote on matters subject to a vote of common unitholders. However, to
preserve our ability to be exempt from U.S. federal income tax under Section 883 of the Code, if at any time, any person or group
owns beneficially more than 4.9% or more of any class of units then outstanding, any such units owned by that person or group in
excess of 4.9% may not be voted (except for purposes of nominating a person for election to our board). The voting rights of any such
unitholders in excess of 4.9% will effectively be redistributed pro rata among the other common unitholders holding less than 4.9% of
the voting power of such class of units. Our general partner, its affiliates and persons who acquired common units with the prior
approval of our board of directors will not be subject to this 4.9% limitation except with respect to voting their common units in the
election of the elected directors.
Committees
We have an audit committee that, among other things, reviews our external financial reporting, engages our external auditors
and oversees our internal audit activities and procedures and the adequacy of our internal accounting controls. Our audit committee is
comprised of three directors, Hans Petter Aas, Kate Blankenship and Bart Veldhuizen. Our board has determined that Mr. Aas,
Ms. Blankenship and Mr. Veldhuizen satisfy the independence standards established by The Nasdaq Stock Market LLC.
Ms. Blankenship qualifies as an ³DXGLWFRPPLWWHHH[SHUW´IRUSXUSRVes of SEC rules and regulations.
We also have a conflicts committee comprised of two members of our board of directors. The conflicts committee will be
DYDLODEOHDWWKHERDUG¶VGLVFUHWLon to review specific matters that the board believes may involve conflicts of interest. The conflicts
committee will determine if the resolution of the conflict of interest is fair and reasonable to us. The members of the conflicts
committee may not be officers or employees of us or directors, officers or employees of our general partner or its affiliates, and must
meet the independence standards established by The Nasdaq Stock Market LLC to serve on an audit committee of a board of directors
and certain other requirements. Any matters approved by the conflicts committee will be conclusively deemed to be fair and
reasonable to us, approved by all of our partners, and not a breach by our directors, our general partner or its affiliates of any duties
any of them may owe us or our unitholders. Our conflicts committee is currently comprised of Paul Leand Jr. and Bart Veldhuizen.
For additional information about the conflicts committee, pleasHUHDG³,WHP²&RQIOLFWVRI,QWHUHVWDQG)LGXFLDU\'XWLHV´
Exemptions from Nasdaq Corporate Governance Rules
Because we qualify as a foreign private issuer under SEC rules, we are permitted to follow the corporate governance
practices of the Marshall Islands (the jurisdiction in which we are organized) in lieu of certain Nasdaq corporate governance
requirements that would otherwise be applicable to us.
Nasdaq rules do not require a listed company that is a foreign private issuer to have a board of directors that is comprised of
a majority of independent directors. Under Marshall Islands law, we are not required to have a board of directors comprised of a
majority of directors meeting the independence standards described in Nasdaq rules. In addition, Nasdaq rules do not require limited
partnerships like us to have boards of directors comprised of a majority of independent directors. Accordingly, our board of directors
is not comprised of a majority of independent directors.
Nasdaq rules do not require foreign private issuers like us to establish a compensation committee or a nominating/corporate
governance committee. Similarly, under Marshall Islands law, we are not required to have a compensation committee or a
nominating/corporate governance committee. In addition, Nasdaq rules do not require
89
limited partnerships like us to have a compensation committee or a nominating/corporate governance committee. Accordingly, we
will not have a compensation committee or a nominating/corporate governance committee.
D. Employees
Employees of Golar Management, including those employees acting as our executive officers, provide services to our
subsidiaries pursuant to the fleet management agreements and the management and administrative services agreement. As of
December 31, 2011, Golar employed (directly and through ship managers) approximately 233 seagoing staff who serve on our
vessels. Golar and its affiliates may employ additional seagoing staff to assist us as we grow. Certain affiliates of Golar, including
Golar Management and Golar Wilhelmsen, provide commercial and technical management services, including all necessary crew-
related services, to our subsidiaries pursuant to the fleet management agreements.
Pursuant to our management agreements, our Manager and certain of its affiliates provide us with all of our employees (other
than our secretary). Our board of directors has the authority to hire other employees as it deems necessary.
E. Unit Ownership
Security Ownership of Certain Beneficial Owners and Management
As of December 31, 2011, there were no common units or subordinated units beneficially owned by:
d each of our current directors;
d each of our current named executive officers; and
d all of our directors and executive officers as a group.
This is based on information filed with the SEC and on information provided to us prior to April 20, 2012.
Item 7. Major Unitholders and Related Party Transactions
A. Major Unitholders
The following table sets forth the beneficial ownership of our common units and subordinated units as of April 26, 2012 by
each person that we know to beneficially own more than 5% of our outstanding common or subordinated units. The number of units
beneficially owned by each person is determined under SEC rules and the information is not necessarily indicative of beneficial
ownership for any other purpose:
Name of Beneficial Owner
Golar LNG Limited(1)
Kayne Anderson Capital Advisors LP(2)
BAMCO, Inc. NY(3)
Number
9,327,254
1,950,746
1,517,350
Percent
Number
Percent
40.3% 15,949,831
²
8.43%
²
6.56%
100%
²
²
Common Units
Beneficially Owned
Subordinated Units
Beneficially Owned
Percentage of Total
Common and
Subordinated Units
Beneficially Owned
63.4%
4.99%
3.88%
(1) World Shipholding Ltd., the company that is the main shareholder of Golar, is indirectly controlled by trusts established by
John Fredriksen, Chairman of the Board of Directors of Golar, for the benefit of his immediate family. Amounts exclude the
2.0% general partner interest held by our general partner, a wholly-owned subsidiary of Golar. The address of World
6KLSKROGLQJ¶VSULQFLSDOSODFHRI business is P.O. Box 53562, CY3399 Limassol, Cyprus.
(2) Based solely on information contained in a Schedule 13G/A filed on February 7, 2012 by Kayne Anderson Capital Advisors
LP. The address of Kayne Anderson Capital Advisors LP is 1800 Avenue of the Stars, Second Floor, Los Angeles CA 90067.
(3) Based solely on the information set forth in a Schedule 13G fiOHGMRLQWO\E\5RQDOG%DURQ%DURQ&DSLWDO*URXS,QF³%&*´
%$0&2,QF³%$0&2´%DURQ&DSLWDO0DQDJHPHQW,QF³%&0´DQG%DURQ6PDOO&DS)XQG³%6&´ZLWKWKH6(&RQ
February 14, 2012. These securities are jointly owned by BCG, BAMCO, BCM, BSC and Ronald Baron. Ronald Baron owns
a controlling interest in BCG. BAMCO and BCM are subsidiaries of BCG. BSC is an advisory client of BAMCO. The
principal business address for all holders is 767 Fifth Avenue, 49th Floor New York, NY 10153.
We are controlled by Golar LNG Limited. We are not aware of any arrangements, the operation of which may at a
subsequent date result in a change in control of us.
90
B. Related Party Transactions
From time to time we have entered into agreements and have consummated transactions with certain related parties. We may
enter into related party transactions from time to time in the future. In connection with our initial public offering, we established a
conflicts committee, comprised entirely of independent directors, which must approve all proposed material related party transactions.
The related party transactions that we have entered into or were party to during the year ended December 31, 2011 are discussed
below.
Net expenses (income) from related parties:
(in thousands of $)
Transactions with Golar and affiliates:
Management and administrative services fees (a)
Ship management fees (b)
Interest expense on Golar LNG vendor financing loan (c)
Total
Receivables (payables) from related parties:
As of December 31, 2011 balances with related parties consisted of the following:
(in thousands of $)
Trading balances due to Golar and affiliates (d)
Golar LNG vendor financing loan (c)
2011
1,576
3,096
3,085
7,757
2011
3,076
(222,310)
(219,234)
(a) Management and administrative services agreement - *RODUPDQDJHPHQWDZKROO\²RZQHGVXEVLGLDU\RI*RODUSURYLGHV
certain, management and administrative services to us pursuant to our amended and restated management and administrative services
agreement. The services provided by Golar Management are charged at cost plus a management fee equal to 5% of Golar
0DQDJHPHQW¶VFRVWVDQGH[SHQVHVLQFXUUHG in connection with providing these services. We may terminate the agreement by
providing 120 days written notice.
(b) Ship management fees - Golar and certain of its affiliates charged ship management fees to us for the provision of technical and
commercial management of the vessels. Each of our vessels is subject to management agreements pursuant to which certain
commercial and technical management services are provided by certain affiliates of Golar, including Golar Management and Golar
Wilhelmsen, a company that is jointly controlled by Golar and Wilhelmsen Ship Management (Norway) AS.
(c) Golar LNG vendor financing loan - In October 2011, in connection with the purchase of the Golar Freeze, we entered into a
financing loan agreement with Golar for an amount of $222.3 million. The facility is unsecured and bears interest at a fixed rate of
6.75% per annum and interest payments are quarterly with a final balloon payment of $222.3 million in October 2014.
(d) Trading balances - Receivables and payables with Golar and its affiliates are comprised primarily of unpaid management fees,
advisory and administrative services. In addition, certain receivables and payables arise when we pay an invoice on behalf of a related
party and vice versa. Receivables and payables are generally settled quarterly in arrears. Trading balances due to Golar and its
affiliates are unsecured, interest-free and intended to be settled in the ordinary course of business. They primarily relate to recharges
for trading expenses paid on our behalf including ship management and administrative service fees due to Golar.
(e) $20 million revolving credit facility - On April 13, 2011, we entered into a $20.0 million revolving credit facility with Golar. The
facility matures in December 2014 and is unsecured and interest-free. As of December 31, 2011, we had not borrowed under the
facility.
91
(f) Dividends to China Petroleum Corporation - During the years ended December 31, 2011, 2010 and 2009, Faraway Maritime
Shipping Co., which is 60% owned by us and 40% owned by ChinD3HWUROHXP&RUSRUDWLRQ³&3&´SDLGGLYLGHQGVWR&3&RI
million, $3.1 million and $1.4 million, respectively.
(g) Acquisition of the Golar Freeze²2Q2FWREHUZHDFTXLUHG*RODU¶V ownership interest in certain subsidiaries
which own and operate the Golar Freeze and hold the secured bank debt. The purchase consideration was $330 million for the vessel
and $9 million of working capital adjustments net of the assumed bank debt of $108 million, resulting in total purchase consideration
of approximately $231 million of which $222.3 million was financed by vendor financing in the form of the Golar LNG facility,
further described in para (c) above. This transaction was concluded between entities under common control and, thus, the net assets
acquired were recorded at historic book value. The excess of the purchase price over the book value of the net assets acquired of
$165.8 million has been accounted for as an equity distribution to Golar. The Board of Directors of the Partnership and the Conflicts
Committee of the Board have approved the purchase price and vendor financing. The Conflicts Committee retained a financial,
advisor DnB Nor Markets, to assist with its evaluation of the transaction. See table below to illustrate the above transaction:
(in millions of $)
Purchase consideration
Net assets of Golar Freeze acquired
- Vessel ± historic book value
- Loan debt assumed
- Other net assets
Subtotal
Net impact to equity of purchase of Golar Freeze
Other Related Party Transactions
2011
166.0
(108.0)
7.5
231.3
65.5
165.8
Prior to our IPO, we operated as a wholly-owned subsidiary of Golar. As such, the Bermudan and London office locations of
Golar have provided general and corporate management services to XVDVZHOODVWR*RODU$VGHVFULEHGLQ1RWH²6LJQLILFDQW
Accounting Policies to our audited consolidated and combined financial statements included elsewhere in this Annual Report, we have
included allocations of certain expenses including general and administrative expenses, derivative related expenses and others relating
to these historical periods which had an aggregate impact on our consolidated and combined net income of $3.3 million for the year
ended December 31, 2011. These allocated costs have been accounted for as an equity contribution.
Omnibus Agreement
At the closing of our IPO, we entered into an omnibus agreement with Golar and certain of its affiliates, our general partner
and certain of our subsidiaries. On October 5, 2011, we entered into an amendment to the omnibus agreement with the other parties
thereto. The following discussion describes certain provisions of the omnibus agreement, as amended.
Noncompetition
Under the omnibus agreement, Golar agreed, and caused its controlled affiliates (other than us, our general partner and our
subsidiaries) to agree, not to acquire, own, operate or charter any FSRU or LNG carrier operating under a charter for five or more
years. We refer to these vessels, togetherZLWKDQ\UHODWHGFKDUWHUVDV³)LYH